Plant FIBer expression Database

Potri.008G099733 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22300 51 / 2e-09 CAMTA SR1, CAMTA3 CALMODULIN-BINDING TRANSCRIPTION ACTIVATOR 3, signal responsive 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G153100
[exp]
105 / 1e-28 AT5G64220 676 / 0.0 Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains (.1.2)
Potri.005G075100
[exp]
44 / 8e-07 AT2G22300 976 / 0.0 CALMODULIN-BINDING TRANSCRIPTION ACTIVATOR 3, signal responsive 1 (.1.2)
Potri.007G093400
[exp]
39 / 4e-05 AT2G22300 991 / 0.0 CALMODULIN-BINDING TRANSCRIPTION ACTIVATOR 3, signal responsive 1 (.1.2)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G099733.1 pacid=42805957 polypeptide=Potri.008G099733.1.p locus=Potri.008G099733 ID=Potri.008G099733.1.v4.1 annot-version=v4.1
ATGGAAGGGAAGGGAAGATTTTTTGAAGATACGCAATCGAATTGTAAAAATTCAGGCTCATGTGAGGGGACATCAAGTTCGAAAGCAATACAAAAGGGTA
GTTTGGTCAGTTGGCATTATCGAAAAGGCAATATTGCGTTGGAGGCGGAAACGTACTGGTTTGCGGTGATTTCAGTTGCAAAAGACACTTGGAGATGTTA
A
AA sequence
>Potri.008G099733.1 pacid=42805957 polypeptide=Potri.008G099733.1.p locus=Potri.008G099733 ID=Potri.008G099733.1.v4.1 annot-version=v4.1
MEGKGRFFEDTQSNCKNSGSCEGTSSSKAIQKGSLVSWHYRKGNIALEAETYWFAVISVAKDTWRC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64220 CAMTA Calmodulin-binding transcripti... Potri.008G099733
[exp]
0 1
AT5G41840 F-box/RNI-like superfamily pro... Potri.006G248600
[exp]
7.28 0.6870
AT5G24130 unknown protein Potri.012G031000
[exp]
16.09 0.6430
Potri.010G007833
[exp]
21.16 0.6402
Potri.019G002628
[exp]
22.80 0.6509
AT5G28780 PIF1 helicase (.1) Potri.011G042150
[exp]
36.52 0.6158
AT5G26594 ARR24 response regulator 24 (.1) Potri.019G024900
[exp]
37.30 0.6158
AT3G19280 FUCTA, FUCT1, A... fucosyltransferase 11 (.1) Potri.019G091200
[exp]
38.07 0.6158 FUCT3.1
Potri.008G209501
[exp]
41.82 0.6125
AT3G44110 ATJ3 DNAJ homologue 3 (.1.2) Potri.014G055300
[exp]
61.64 0.6190
AT1G65690 Late embryogenesis abundant (L... Potri.013G135800
[exp]
78.03 0.5947

Potri.008G099733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.