Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48810 152 / 3e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53700 125 / 2e-33 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39710 111 / 2e-28 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 110 / 3e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63630 101 / 2e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G18475 107 / 4e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G46100 105 / 2e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64580 103 / 8e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G16710 102 / 2e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G11690 101 / 5e-25 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G148700 [exp] 277 / 3e-90 AT3G48810 728 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G013300 [exp] 117 / 2e-30 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G046000 [exp] 116 / 4e-30 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 111 / 2e-28 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G069600 [exp] 109 / 1e-27 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G025600 [exp] 105 / 2e-26 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G141800 [exp] 104 / 3e-26 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.001G075900 [exp] 102 / 2e-25 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G045000 [exp] 102 / 2e-25 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009023 [exp] 139 / 2e-38 AT3G48810 543 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 114 / 1e-29 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10006373 [exp] 114 / 2e-29 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009201 [exp] 107 / 4e-28 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10020134 [exp] 105 / 2e-27 AT1G12700 254 / 3e-78 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10008593 [exp] 107 / 3e-27 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003427 [exp] 106 / 4e-27 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10015397 [exp] 103 / 5e-26 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021074 [exp] 102 / 1e-25 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039056 [exp] 102 / 3e-25 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.008G102100.2 pacid=42808449 polypeptide=Potri.008G102100.2.p locus=Potri.008G102100 ID=Potri.008G102100.2.v4.1 annot-version=v4.1 ATGCTGCTCTGGCTAATAACAACCGCTCCCTCGTCCGGGAATTTAATGTTCAATCATGCTCATCATCTTATAGAGAATATGGCGAATGAAAATTGTCCTC CAAATACAATTACATCCAATACATTTATCAAAGGTTTATGTTGCAGTGGAAAGGTGGAGTGGGCAATGAAAGTGCTCGATCAAATGGGGAAATATGGGTG TTCACCTAATGTCACAAAATATAATGAACTTTTGGATGGTCTTTTCAATGCAAACAGAATACAAGAAGCTCTTCGGATAGTTGGAGAGATAGAAGAAATG GAGATCGAGTTGAATTTAGTGACTTATAATACCATTTTGTCTGGATTTTGTCATGCTGGAATGCTAAAAGATGCTTCGCAGCTTGTTGGGAAAATGCTGG TTGGGGGAACCAAGCCTGATGCCATCACATATAACACGGTAATTTATGCATACTGTGAGCAAGGCGAGGTAAAGACTGCCGTCCAGCTTGTAGATAGATT AACAGAGGAGAGGGGTATCCAAACATATTTACATGCACTAGTCTTTTGGGGGGTTCTGCAATTGGATTGGAGTACATGA
AA sequence Show only first row Show all	>Potri.008G102100.2 pacid=42808449 polypeptide=Potri.008G102100.2.p locus=Potri.008G102100 ID=Potri.008G102100.2.v4.1 annot-version=v4.1 MLLWLITTAPSSGNLMFNHAHHLIENMANENCPPNTITSNTFIKGLCCSGKVEWAMKVLDQMGKYGCSPNVTKYNELLDGLFNANRIQEALRIVGEIEEM EIELNLVTYNTILSGFCHAGMLKDASQLVGKMLVGGTKPDAITYNTVIYAYCEQGEVKTAVQLVDRLTEERGIQTYLHALVFWGVLQLDWST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G48810			Pentatricopeptide repeat (PPR)...		Potri.008G102100 [exp]	0	1
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G046100 [exp]	7.74	0.7786
AT2G19680			Mitochondrial ATP synthase sub...		Potri.018G055501 [exp]	10.00	0.7771
AT1G52380			NUP50 (Nucleoporin 50 kDa) pro...		Potri.001G179100 [exp]	10.95	0.8256
AT4G14300			RNA-binding (RRM/RBD/RNP motif...		Potri.010G067500 [exp]	12.80	0.7918
AT3G59800			unknown protein		Potri.017G010100 [exp]	14.96	0.7698
AT2G44200			CBF1-interacting co-repressor ...		Potri.016G000501 [exp]	20.34	0.7895
AT5G37720		DIP2, ALY4	interacting with DNA-binding d...		Potri.004G087000 [exp]	26.92	0.7355
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G050300 [exp]	27.00	0.7677
AT5G60340			P-loop containing nucleoside t...		Potri.012G109400 [exp]	33.24	0.7424
AT1G20230			Pentatricopeptide repeat (PPR)...		Potri.002G021300 [exp]	47.41	0.7691

Compare expression of checked genes

Potri.008G102100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.