Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17130 154 / 7e-48 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G47960 67 / 5e-14 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17152 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17140 49 / 5e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 49 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 47 / 1e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT3G17150 47 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 39 / 0.0005 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G063000 [exp] 98 / 6e-26 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.009G083500 [exp] 96 / 2e-25 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.006G134900 [exp] 66 / 1e-13 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.001G288500 [exp] 57 / 6e-11 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.003G086600 [exp] 58 / 9e-11 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G209800 [exp] 49 / 3e-07 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.008G013400 [exp] 49 / 3e-07 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.001G109700 [exp] 47 / 1e-06 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.007G108301 [exp] 46 / 2e-06 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037791 [exp] 159 / 1e-49 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10016319 [exp] 155 / 3e-48 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10002739 [exp] 152 / 2e-47 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017074 [exp] 147 / 6e-45 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027947 [exp] 84 / 2e-20 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 81 / 2e-19 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 76 / 1e-17 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 76 / 2e-17 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037792 [exp] 76 / 2e-17 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 76 / 4e-17 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.008G102600.1 pacid=42805881 polypeptide=Potri.008G102600.1.p locus=Potri.008G102600 ID=Potri.008G102600.1.v4.1 annot-version=v4.1 ATGAGAACTTCAGTCTCTTCACTGTCCATTCTCCTTTACATCCTCCTCCTCTCAGCTCCTTTACCACTAACCCAATGTGGTGATCTAGTAGGCCAGATAT GCAAGAAGACACCCTTCTACGACCTTTGTGTCTTGTCCTTACAACCAAACTCAGGGACTGATGTTAAAACTCTAGCCTCTAAAATGGCTAATCTCGTCCT GTCCAATGTGACCGATACCCTGAATTTCATCCAAGGCTTAGTTAAACAGGAAACTGGGACATCATTAGAGAGGCCACTGGCTGATTGTGCAGAGTTGTAC ATACCAGTTGTCAAGTACAATCTTCCTCAAGCCATTGATGCTTTGATTAGAGGAAGGTATGGATTTGCCGATTATGTTTTTTCTGATGTTTCCAAACAAG CTGATGCTTGTGAAAAAAACTTCTCGGGCGAGGATGAATCACCATTGACTGATAGGAATAAACTTATCAGCAATCTTTGTGATGTCGCGGTAGCCATTAT CAATATATTGCAGAAGGGTTTCTGA
AA sequence Show only first row Show all	>Potri.008G102600.1 pacid=42805881 polypeptide=Potri.008G102600.1.p locus=Potri.008G102600 ID=Potri.008G102600.1.v4.1 annot-version=v4.1 MRTSVSSLSILLYILLLSAPLPLTQCGDLVGQICKKTPFYDLCVLSLQPNSGTDVKTLASKMANLVLSNVTDTLNFIQGLVKQETGTSLERPLADCAELY IPVVKYNLPQAIDALIRGRYGFADYVFSDVSKQADACEKNFSGEDESPLTDRNKLISNLCDVAVAIINILQKGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G17130			Plant invertase/pectin methyle...		Potri.008G102600 [exp]	0	1
AT4G25780			CAP (Cysteine-rich secretory p...		Potri.018G096028 [exp]	1.00	0.8246
AT2G13610		ABCG5	ATP-binding cassette G5, ABC-2...		Potri.005G064300 [exp]	2.44	0.8157	PtrWBC5-1
AT1G48100			Pectin lyase-like superfamily ...		Potri.008G100500 [exp]	2.82	0.7717
AT4G17085			Putative membrane lipoprotein ...		Potri.003G085400 [exp]	4.00	0.7501
AT5G19730			Pectin lyase-like superfamily ...		Potri.018G068400 [exp]	5.91	0.7708
AT1G14890			Plant invertase/pectin methyle...		Potri.008G132600 [exp]	6.70	0.7731
AT1G60590			Pectin lyase-like superfamily ...		Potri.010G042100 [exp]	7.74	0.7212
AT3G51080	GATA	GATA6	GATA transcription factor 6 (....		Potri.007G016600 [exp]	8.77	0.7289
AT1G48100			Pectin lyase-like superfamily ...		Potri.010G152000 [exp]	8.83	0.7158
AT3G55580			Regulator of chromosome conden...		Potri.010G199100 [exp]	10.67	0.6788

Compare expression of checked genes

Potri.008G102600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.