Potri.008G105700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67620 184 / 2e-59 Lojap-related protein (.1)
AT3G12930 55 / 3e-09 Lojap-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G142900 54 / 7e-09 AT3G12930 321 / 6e-112 Lojap-related protein (.1)
Potri.001G458600 53 / 1e-08 AT3G12930 301 / 6e-104 Lojap-related protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015822 223 / 7e-75 AT1G67620 168 / 2e-53 Lojap-related protein (.1)
Lus10036979 166 / 6e-53 AT1G67620 129 / 1e-38 Lojap-related protein (.1)
Lus10002544 54 / 6e-09 AT3G12930 284 / 2e-97 Lojap-related protein (.1)
Lus10027381 52 / 3e-08 AT3G12930 280 / 5e-96 Lojap-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0260 NTP_transf PF02410 RsfS Ribosomal silencing factor during starvation
Representative CDS sequence
>Potri.008G105700.3 pacid=42806963 polypeptide=Potri.008G105700.3.p locus=Potri.008G105700 ID=Potri.008G105700.3.v4.1 annot-version=v4.1
ATGTTGGCTGCAACTCTGCGATCTCGGTCTCTTCATCTCTCATCTTCACTCCTGAATCATCCATGGAAACCTGTGTTGTCAGGTTCCGGTCATACTTTCT
CTTCATCAGCTGTTGAATCCAACAGTGACAGAAGCATACTGGACCTAAACGAGATAGAGAAGGTTCTCACTGATGTGAGAGCAGATGACGTGAAAGTTAT
ACCAGCTAAAAAGCACGCTGAATGGGCTGATTATATGGTCATTGCCACTGGCAGGTCCACATGGCATGTCAAAAACATTGCTCAAGCCCTTATTTACAAG
GCTAAGCAAAAGCAAAAGGGGGCTCAGCGAATGACCCTCCCCAGTGTGGAAGGGCAAGAGGGAGGAAAGTGGATTGTTATTGACTCTGGCAAGGTGATAG
TTCATGCTCTTGACGAGAAAGCTCGAGCGTACTACAATTTGGAAAGTCTTTGGACCTCAGATGCATCTAAAGAGGAACCAGATCAGGACTTGGATAAAGC
TTTTATCAAGATTCGTCCCAAGAGAAACAATTCTAAAAGACCAGCAAATAGAGGTGCCTGA
AA sequence
>Potri.008G105700.3 pacid=42806963 polypeptide=Potri.008G105700.3.p locus=Potri.008G105700 ID=Potri.008G105700.3.v4.1 annot-version=v4.1
MLAATLRSRSLHLSSSLLNHPWKPVLSGSGHTFSSSAVESNSDRSILDLNEIEKVLTDVRADDVKVIPAKKHAEWADYMVIATGRSTWHVKNIAQALIYK
AKQKQKGAQRMTLPSVEGQEGGKWIVIDSGKVIVHALDEKARAYYNLESLWTSDASKEEPDQDLDKAFIKIRPKRNNSKRPANRGA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67620 Lojap-related protein (.1) Potri.008G105700 0 1
AT1G28960 ATNUDX15, ATNUD... ARABIDOPSIS THALIANA NUDIX HYD... Potri.011G063300 1.73 0.8139
AT5G10460 Haloacid dehalogenase-like hyd... Potri.019G099100 7.48 0.7541
AT4G38020 tRNA/rRNA methyltransferase (S... Potri.005G147600 12.96 0.7454
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Potri.015G057400 28.98 0.7533
AT3G54640 TRP3, TSA1 TRYPTOPHAN-REQUIRING 3, trypto... Potri.005G217700 29.56 0.6956 TSA1.1
AT5G03220 Mediator complex, subunit Med7... Potri.016G062800 32.68 0.7514
AT1G51730 Ubiquitin-conjugating enzyme f... Potri.001G193700 33.46 0.7023
AT1G65290 MTACP2 mitochondrial acyl carrier pro... Potri.019G055300 35.74 0.7388
AT5G63000 Mitochondrial import inner mem... Potri.015G078600 37.22 0.6608
AT2G45440 DHDPS2 dihydrodipicolinate synthase (... Potri.002G149500 38.49 0.7094 Pt-DHDPS2.1

Potri.008G105700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.