Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29260 133 / 9e-39 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29290 126 / 6e-37 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G29370 125 / 2e-36 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29360 123 / 1e-35 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29350 121 / 5e-35 SAG13 senescence-associated gene 13 (.1.2.3) AT5G06060 120 / 2e-34 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G30670 117 / 4e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29150 117 / 5e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29310 114 / 5e-32 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G29340 114 / 5e-32 NAD-dependent epimerase/dehydratase family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G142600 [exp] 173 / 4e-55 AT2G29290 354 / 3e-124 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.013G026000 [exp] 156 / 2e-48 AT2G29290 362 / 2e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.005G039500 [exp] 152 / 8e-47 AT2G29150 351 / 5e-123 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.005G039300 [exp] 147 / 1e-44 AT2G29150 356 / 7e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G244900 [exp] 135 / 1e-39 AT2G29260 387 / 4e-135 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G245000 [exp] 132 / 4e-39 AT2G29150 343 / 9e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.008G059100 [exp] 119 / 9e-34 AT5G06060 416 / 8e-149 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.010G199700 [exp] 103 / 1e-29 AT5G06060 145 / 1e-44 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.006G089700 [exp] 102 / 1e-27 AT5G06060 320 / 6e-111 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040736 [exp] 135 / 5e-40 AT5G06060 382 / 3e-135 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10040730 [exp] 134 / 9e-39 AT2G29260 405 / 2e-142 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10040271 [exp] 126 / 1e-36 AT5G06060 388 / 2e-137 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10004704 [exp] 124 / 1e-35 AT5G06060 387 / 3e-137 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10016495 [exp] 114 / 1e-33 AT5G06060 128 / 7e-38 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10001560 [exp] 120 / 4e-33 AT5G06060 350 / 1e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10016494 [exp] 116 / 9e-33 AT5G06060 333 / 7e-116 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10040737 [exp] 116 / 9e-33 AT2G29350 332 / 3e-115 senescence-associated gene 13 (.1.2.3) Lus10004985 [exp] 116 / 8e-32 AT2G29340 322 / 5e-110 NAD-dependent epimerase/dehydratase family protein (.1.2.3) Lus10016499 [exp] 111 / 8e-31 AT5G06060 337 / 2e-117 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF13561 [poplar] [flax] adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Representative CDS sequence Show only first row Show all	>Potri.008G107001.1 pacid=42808798 polypeptide=Potri.008G107001.1.p locus=Potri.008G107001 ID=Potri.008G107001.1.v4.1 annot-version=v4.1 ATGAGTGTGTACCAGTTCTACCCTGAACGGAATGCTATCGTGGAAGAAATGGCAGCACTTGGAGCAGTTGTTCATACATTGTGGTATCTGTCAACATTGG ATATCCTATTTATTCAGCTGCTAAAAGGGGGGATTCATCAACTCACAAGGAACCTGGCATGCGAATTGGCTAAAGACAATATAAGGGTTAATTCCGTCGC CCCTTGGTTCATCAGAACCCCGATGACTGAAGATGGTCTTAAAAATGAAAATGTGGTGAAGGAGCTTGCTTATCAGACCCCCATGCGACGTTCTGGAGAA CCCGGAGAAGTCTCTCCTGTTGTCGCATTTCTTTGCCTCCCCGCGCCATCTTTTACAACCGGACAGGTCATTTGTATTGGTGGAGGGATGTCAGTGAACG GCTTTTTCATGGGTTGA
AA sequence Show only first row Show all	>Potri.008G107001.1 pacid=42808798 polypeptide=Potri.008G107001.1.p locus=Potri.008G107001 ID=Potri.008G107001.1.v4.1 annot-version=v4.1 MSVYQFYPERNAIVEEMAALGAVVHTLWYLSTLDILFIQLLKGGIHQLTRNLACELAKDNIRVNSVAPWFIRTPMTEDGLKNENVVKELAYQTPMRRSGE PGEVSPVVAFLCLPAPSFTTGQVICIGGGMSVNGFFMG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G29260			NAD(P)-binding Rossmann-fold s...		Potri.008G107001 [exp]	0	1
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Potri.005G222401 [exp]	18.97	0.4434
AT5G50140			Ankyrin repeat family protein ...		Potri.001G187600 [exp]	19.82	0.4995
AT1G01490			Heavy metal transport/detoxifi...		Potri.018G148900 [exp]	29.59	0.4765
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.005G095500 [exp]	31.63	0.4754	TPS1.2
					Potri.015G106750 [exp]	41.25	0.4331
AT4G33550			Bifunctional inhibitor/lipid-t...		Potri.009G049300 [exp]	63.46	0.4125
AT3G55260		HEXO1, ATHEX2	beta-hexosaminidase 1 (.1)		Potri.008G049801 [exp]	68.41	0.4019
					Potri.001G276104 [exp]	91.49	0.3795
AT5G66680		DGL1	DEFECTIVE GLYCOSYLATION, dolic...		Potri.004G151050 [exp]	93.67	0.4120
AT5G11950		LOG8	LONELY GUY 8, Putative lysine ...		Potri.003G219300 [exp]	135.86	0.3948

Compare expression of checked genes

Potri.008G107001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.