Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06700 106 / 2e-32 Ribosomal L29e protein family (.1.2.3) AT3G06680 104 / 8e-32 Ribosomal L29e protein family (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G142001 [exp] 118 / 3e-37 AT3G06700 103 / 2e-31 Ribosomal L29e protein family (.1.2.3) Potri.002G196800 [exp] 102 / 6e-31 AT3G06700 96 / 2e-28 Ribosomal L29e protein family (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016875 [exp] 103 / 2e-31 AT3G06700 100 / 2e-30 Ribosomal L29e protein family (.1.2.3) Lus10037740 [exp] 103 / 2e-31 AT3G06700 100 / 2e-30 Ribosomal L29e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01779 [poplar] [flax] Ribosomal_L29e Ribosomal L29e protein family
Representative CDS sequence Show only first row Show all	>Potri.008G107700.4 pacid=42807855 polypeptide=Potri.008G107700.4.p locus=Potri.008G107700 ID=Potri.008G107700.4.v4.1 annot-version=v4.1 ATGGCCAAGTCAAAGAATCACACAGCACACAACCAGTCCCACAAAGCTCACAAGAATGGCATCAAGAAACCCAAGAGGCATCGCCACACCTCCACGAAAG GGATGGACCCTAAGTTTTTGAGGAACCAGAGATATGCAAGGAAGCATAACAAGAAGTGTGGTGACTCGGCCACCGAGGAAGAGTAG
AA sequence Show only first row Show all	>Potri.008G107700.4 pacid=42807855 polypeptide=Potri.008G107700.4.p locus=Potri.008G107700 ID=Potri.008G107700.4.v4.1 annot-version=v4.1 MAKSKNHTAHNQSHKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G06700			Ribosomal L29e protein family ...		Potri.008G107700 [exp]	0	1
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.002G190000 [exp]	5.29	0.8594
AT4G35490		MRPL11	mitochondrial ribosomal protei...		Potri.007G058600 [exp]	5.91	0.8344
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Potri.014G192601 [exp]	7.21	0.8367
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.001G069100 [exp]	7.48	0.8269	Pt-ARS27.2
AT3G62840			Small nuclear ribonucleoprotei...		Potri.014G129100 [exp]	8.30	0.8417
AT1G22270			Trm112p-like protein (.1)		Potri.005G165000 [exp]	9.79	0.7985
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Potri.001G273200 [exp]	13.63	0.7215
AT5G59850			Ribosomal protein S8 family pr...		Potri.010G208700 [exp]	15.29	0.8336	Pt-WRP15.1
AT5G61170			Ribosomal protein S19e family ...		Potri.004G118800 [exp]	18.11	0.8456	RPS19.1
AT3G05810			unknown protein		Potri.013G007600 [exp]	18.16	0.7774

Compare expression of checked genes

Potri.008G107700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.