Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G03720 186 / 6e-60 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G17390 173 / 4e-53 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03290 169 / 1e-51 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G44760 103 / 6e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G13450 79 / 9e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G48960 57 / 8e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 49 / 4e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G07020 49 / 1e-06 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G11360 48 / 1e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T170801 [exp] 486 / 2e-177 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G140200 [exp] 411 / 1e-147 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.015G060700 [exp] 226 / 7e-75 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G084600 [exp] 115 / 2e-31 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G177100 [exp] 112 / 3e-30 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G064800 [exp] 96 / 4e-24 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.013G009800 [exp] 54 / 4e-09 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 49 / 3e-07 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.012G059100 [exp] 47 / 2e-06 AT1G48960 175 / 3e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019173 [exp] 268 / 4e-91 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 168 / 6e-52 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10036814 [exp] 155 / 1e-48 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10007982 [exp] 158 / 2e-47 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025644 [exp] 103 / 2e-27 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10018190 [exp] 99 / 8e-26 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029664 [exp] 96 / 5e-24 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10042701 [exp] 94 / 1e-23 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10014459 [exp] 90 / 1e-21 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10032598 [exp] 82 / 8e-19 AT4G13450 177 / 7e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.008G109000.1 pacid=42807324 polypeptide=Potri.008G109000.1.p locus=Potri.008G109000 ID=Potri.008G109000.1.v4.1 annot-version=v4.1 ATGGGCAAGATAGACACAAGATTACCAGGTTTCTGTCTAAACAGGATCAAGCCTCGTGTTAGAGTCCGCTCACCACCTATACAAGCCAAGCCTAATCTGA ATTCTACTAAAAATGATCAAAACAATGAGAATCCTGACAGTACTGTTGTTGGAGATCAGGAGAAGCCTGGGAATTCGGAGGGAAAACCCGTGGAGTTAAT CGGTAGGAAAATCATGATAGTGGTCGATTCAAGTATTGAAGCTCAGGGAGCTTTACAATGGGCACTCTCTCACACTGTTCAAAGCCAGGATCTTCTTATT CTTCTTCATGTAACTAAAGAATCTTCTAAGCAAGCCACAGGGACAAAAACCCGCAAGGAGAGAGGAGCTCCAAGGGCCTGTGAACTTGTAAATTCTGTGA AAAATATGTGTCAGTTGAAGAGACCTGAGATACAAATTGAGATTGCAGTGGTGGAAGGAAAAGAGAAAGGTCCATTGATAGTGGAAGAGGCCAAGAAACA AGAGGTGGCACTTCTAGTTTTGGGGCAGAAAAAGAGGTCCATGACATGGCGGCTGATCATGATGTGGGCAAGCAATAGAGTCACCGGTGGTGTGGTGGAA TACTGTATCCAAAATGCTGATTGCATGGCAATTGCTGTGAGGAGGAAAAGCCAAAAACATGGAGGTTACTTGATTACCACAAAGCGTCACAAAGATTTCT GGCTTTTAGCTTAA
AA sequence Show only first row Show all	>Potri.008G109000.1 pacid=42807324 polypeptide=Potri.008G109000.1.p locus=Potri.008G109000 ID=Potri.008G109000.1.v4.1 annot-version=v4.1 MGKIDTRLPGFCLNRIKPRVRVRSPPIQAKPNLNSTKNDQNNENPDSTVVGDQEKPGNSEGKPVELIGRKIMIVVDSSIEAQGALQWALSHTVQSQDLLI LLHVTKESSKQATGTKTRKERGAPRACELVNSVKNMCQLKRPEIQIEIAVVEGKEKGPLIVEEAKKQEVALLVLGQKKRSMTWRLIMMWASNRVTGGVVE YCIQNADCMAIAVRRKSQKHGGYLITTKRHKDFWLLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G69080			Adenine nucleotide alpha hydro...		Potri.008G109000 [exp]	0	1
AT3G06840			unknown protein		Potri.001G162100 [exp]	2.64	0.9234
AT4G38650			Glycosyl hydrolase family 10 p...		Potri.004G173300 [exp]	2.82	0.9006
AT3G54260		TBL36	TRICHOME BIREFRINGENCE-LIKE 36...		Potri.008G020900 [exp]	3.16	0.9193
AT1G69080			Adenine nucleotide alpha hydro...		Potri.010G140200 [exp]	4.47	0.8768
AT2G47930		AGP26, ATAGP26	ARABIDOPSIS THALIANA ARABINOGA...		Potri.002G207500 [exp]	6.00	0.8868
AT4G12420		SKU5	Cupredoxin superfamily protein...		Potri.001G120300 [exp]	7.93	0.9174	SKU5.2
AT2G35150		EXL7, EXL1	EXORDIUM LIKE 7, EXORDIUM like...		Potri.015G122100 [exp]	8.00	0.8782
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.012G105500 [exp]	8.94	0.8918
AT1G71380		ATCEL3 ,ATGH9B3	ARABIDOPSIS THALIANA GLYCOSYL ...		Potri.019G069300 [exp]	13.22	0.8718
AT4G22250			RING/U-box superfamily protein...		Potri.014G158900 [exp]	15.00	0.9004

Compare expression of checked genes

Potri.008G109000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.