Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08180 226 / 6e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) AT5G20160 60 / 5e-12 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) AT4G12600 59 / 8e-12 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) AT4G22380 59 / 8e-12 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT2G47610 47 / 1e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G62870 43 / 3e-05 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G087100 [exp] 62 / 6e-13 AT4G12600 213 / 9e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Potri.013G116800 [exp] 61 / 2e-12 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Potri.017G100800 [exp] 44 / 1e-05 AT3G62870 377 / 1e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.017G101000 [exp] 44 / 1e-05 AT3G62870 376 / 3e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.004G113800 [exp] 44 / 2e-05 AT3G62870 399 / 5e-142 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.001G326400 [exp] 42 / 7e-05 AT2G47610 385 / 1e-136 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.004G113900 [exp] 42 / 8e-05 AT3G62870 362 / 7e-127 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000421 [exp] 255 / 1e-88 AT5G08180 240 / 9e-83 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10040161 [exp] 249 / 4e-86 AT5G08180 226 / 4e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10004366 [exp] 246 / 4e-85 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10010993 [exp] 241 / 5e-83 AT5G08180 229 / 3e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10019420 [exp] 63 / 3e-12 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1) Lus10017031 [exp] 61 / 3e-12 AT4G22380 220 / 2e-75 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10043276 [exp] 63 / 4e-12 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1) Lus10015295 [exp] 58 / 2e-10 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10025435 [exp] 57 / 4e-10 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10012463 [exp] 42 / 5e-05 AT3G62870 457 / 2e-165 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [poplar] [flax] PELOTA PF01248 [poplar] [flax] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Potri.008G110100.1 pacid=42807278 polypeptide=Potri.008G110100.1.p locus=Potri.008G110100 ID=Potri.008G110100.1.v4.1 annot-version=v4.1 ATGGGAAGTGATAGCGAAACAGAGAGATCAAACATAAAAGAGAAGAAGAAGATAACAAGCTTGGCTCCCATTGCCAAACCCTTAGCTGGCAAAAAACTCT GCAAACGAACTCTGAAGCTCGTTCGTAAAGCATCTGAATCAAAATGCTTGAAGAGAGGAGTGAAGGAAGTAGTGAAGAGCATTCGTCGTGGCCATAAAGG ATTATGCATAATAGCTGGAAACATTTCACCAATCGATGTCATTACTCATGTTCCCATCTTATGTGAAGAGTCTGACATTCCTTATGTTTATGTTACTTCT AAAGAAGACCTCGCTAGTGCTGGAGCCACCAAAAGGCCTACTTGTTGTGTTCTAGTGTTAACCAAGCCTACCAAGGGGGAGATAGGCAAGGAGGATCAAG AAAAATTGAAGGCAGATTATGATCAAGTTGTTTCTGATGTATCTGAACTTACTTCCTCACTTTTTTGA
AA sequence Show only first row Show all	>Potri.008G110100.1 pacid=42807278 polypeptide=Potri.008G110100.1.p locus=Potri.008G110100 ID=Potri.008G110100.1.v4.1 annot-version=v4.1 MGSDSETERSNIKEKKKITSLAPIAKPLAGKKLCKRTLKLVRKASESKCLKRGVKEVVKSIRRGHKGLCIIAGNISPIDVITHVPILCEESDIPYVYVTS KEDLASAGATKRPTCCVLVLTKPTKGEIGKEDQEKLKADYDQVVSDVSELTSSLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Potri.008G110100 [exp]	0	1
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.001G454101 [exp]	2.00	0.9454
AT3G13580			Ribosomal protein L30/L7 famil...		Potri.018G140300 [exp]	2.00	0.9396
AT3G06700			Ribosomal L29e protein family ...		Potri.010G142001 [exp]	2.44	0.9257
AT4G17520			Hyaluronan / mRNA binding fami...		Potri.001G153000 [exp]	4.47	0.9097
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.001G453900 [exp]	6.24	0.9361
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Potri.004G113800 [exp]	6.92	0.9225	RPL7.5
AT1G25260			Ribosomal protein L10 family p...		Potri.011G156300 [exp]	9.59	0.8884
AT2G41840			Ribosomal protein S5 family pr...		Potri.016G055000 [exp]	10.72	0.9324	Pt-RPS2.3
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.001G454000 [exp]	12.96	0.9348
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.012G139400 [exp]	13.22	0.9244

Compare expression of checked genes

Potri.008G110100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.