Potri.008G112400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04025 43 / 7e-06 RGF3 root meristem growth factor 3, unknown protein
AT1G13620 40 / 6e-05 RGF2 root meristem growth factor 2, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019202 40 / 0.0002 AT1G13620 44 / 4e-06 root meristem growth factor 2, unknown protein
Lus10036841 39 / 0.0003 ND 42 / 2e-05
Lus10036838 39 / 0.0003 ND 42 / 2e-05
PFAM info
Representative CDS sequence
>Potri.008G112400.2 pacid=42808033 polypeptide=Potri.008G112400.2.p locus=Potri.008G112400 ID=Potri.008G112400.2.v4.1 annot-version=v4.1
ATGAAAATGGCTGCTTCGCCTGTGAAGTTTACATGCTTGCTGCTCTTACTGCTGTTTACAAGTGCATGGCTCAACAGTGCACGTGCCCATCCAACAGCTG
TGGAAGTCGATACTTTTTCAAGTGAAAGGATAATAGTGGATGGCGATGGAATGGTCACGACCAGCATTAAAAAGATAGGAGGAAGAAAAGTGGTTCGAGC
CCACAACATCAAAAGGCCAGACATTAAAGGCAATGTAGCGCATGGAGGGACCTCAAGGATTTCGAGTGCAAATGATCAAGTGGTTGGAAAATATGGCTAC
GAAAGAGAGGTTATGGATATAGGAAATAAGCGAAACGGGGGTCGATTTCCTGAAGGGGTTAAAGAGTCAGGTTTTGTAGCTTTTAATGCTGATTACCATG
AGCCTAGGCACCATCCACCTAAAAATAATTGA
AA sequence
>Potri.008G112400.2 pacid=42808033 polypeptide=Potri.008G112400.2.p locus=Potri.008G112400 ID=Potri.008G112400.2.v4.1 annot-version=v4.1
MKMAASPVKFTCLLLLLLFTSAWLNSARAHPTAVEVDTFSSERIIVDGDGMVTTSIKKIGGRKVVRAHNIKRPDIKGNVAHGGTSRISSANDQVVGKYGY
EREVMDIGNKRNGGRFPEGVKESGFVAFNADYHEPRHHPPKNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G04025 RGF3 root meristem growth factor 3,... Potri.008G112400 0 1
AT1G29660 GDSL-like Lipase/Acylhydrolase... Potri.012G060700 9.32 0.6354
AT3G43860 ATGH9A4 glycosyl hydrolase 9A4 (.1) Potri.006G219700 12.64 0.5957
AT1G18970 GLP4 germin-like protein 4 (.1) Potri.013G116500 15.09 0.7021
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Potri.009G091950 15.49 0.5545
AT5G06990 Protein of unknown function, D... Potri.003G193700 16.15 0.5044
Potri.009G026850 17.32 0.5430
AT3G02645 Plant protein of unknown funct... Potri.017G124100 20.71 0.5491
AT4G31830 unknown protein Potri.018G018300 24.89 0.5271
Potri.005G022400 26.98 0.5153
AT5G12180 CPK17 calcium-dependent protein kina... Potri.001G274700 30.39 0.5242

Potri.008G112400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.