Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68930 155 / 1e-44 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G20540 94 / 5e-23 MEF21 mitochondrial editing factor 21 (.1) AT2G13600 88 / 7e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G06540 87 / 1e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G21090 84 / 3e-19 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G13770 82 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G77010 81 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59200 81 / 2e-18 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G04780 77 / 7e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G62890 77 / 8e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G136200 [exp] 238 / 5e-75 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.006G213200 [exp] 89 / 3e-21 AT5G42450 545 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G202600 [exp] 84 / 1e-19 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G220600 [exp] 82 / 1e-18 AT3G26630 481 / 2e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G041200 [exp] 82 / 1e-18 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.017G141200 [exp] 79 / 1e-17 AT5G66520 407 / 1e-135 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G109800 [exp] 79 / 1e-17 AT3G51320 528 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G047800 [exp] 79 / 2e-17 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G104700 [exp] 79 / 2e-17 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030908 [exp] 182 / 9e-54 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10030581 [exp] 170 / 2e-49 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10014298 [exp] 85 / 1e-19 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030125 [exp] 85 / 1e-19 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1) Lus10026006 [exp] 84 / 3e-19 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005064 [exp] 82 / 8e-19 AT2G21090 513 / 2e-179 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10034408 [exp] 82 / 1e-18 AT5G42450 538 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007341 [exp] 82 / 2e-18 AT2G42920 610 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10040504 [exp] 81 / 5e-18 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016425 [exp] 79 / 1e-17 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.008G113101.1 pacid=42805941 polypeptide=Potri.008G113101.1.p locus=Potri.008G113101 ID=Potri.008G113101.1.v4.1 annot-version=v4.1 ATGGAGGTAGTTAAAGCTTATAGCTTGATGTTGAAAGATGGGATTTATAATTTGAATAGGATTACATTATCGACAATGCTTATGTTGGTATTGAGTCAAG GGTGTGTTGGTTTGGGTAGGCAGATTCATGGGCAGGTAGTGAAATTTGGATTTGGGGCCTATGTTTTTGTAGGGAGTCCTTTGGTGGATATGTATGCCAA AATGGGATTAGTTTCCGAGGCAAAGCAGGTTTTTGACGAGGTTCAAGAGAGGAGCATGTTAATGTTTAATACGATGATTACAGGGCTTTTGAGTTGTGGG GTGGTAGAGGATTCAAAGAGGCTGCTTCATGATATGAAGGAAAGAGTTTCCATTTCGTGGACAAAATGGAATGGAGGCGAAGTTATAGATTTGTTCAGAG ATATGGGGCTAGAAGGCATGGCGATGAAACAGTATACATTTGGCAATGTGTTGACTGCATGTGGGGGGCTTATGGTTTGA
AA sequence Show only first row Show all	>Potri.008G113101.1 pacid=42805941 polypeptide=Potri.008G113101.1.p locus=Potri.008G113101 ID=Potri.008G113101.1.v4.1 annot-version=v4.1 MEVVKAYSLMLKDGIYNLNRITLSTMLMLVLSQGCVGLGRQIHGQVVKFGFGAYVFVGSPLVDMYAKMGLVSEAKQVFDEVQERSMLMFNTMITGLLSCG VVEDSKRLLHDMKERVSISWTKWNGGEVIDLFRDMGLEGMAMKQYTFGNVLTACGGLMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68930			pentatricopeptide (PPR) repeat...		Potri.008G113101 [exp]	0	1
AT4G16510			YbaK/aminoacyl-tRNA synthetase...		Potri.001G122501 [exp]	8.77	0.8276
AT1G49880		EMB3106, AtErv1...	EMBRYO DEFECTIVE 3106, Erv1/Al...		Potri.001G296000 [exp]	10.39	0.8655
AT2G20330			Transducin/WD40 repeat-like su...		Potri.014G193500 [exp]	13.03	0.8152
AT4G36650		ATPBRP	plant-specific TFIIB-related p...		Potri.007G027600 [exp]	15.36	0.8422
AT3G26990			ENTH/VHS family protein (.1)		Potri.001G325700 [exp]	16.27	0.8360
AT2G39950			unknown protein		Potri.008G064500 [exp]	16.30	0.8052
AT2G31260		ATAPG9, APG9	autophagy 9 (APG9) (.1)		Potri.002G039900 [exp]	18.16	0.8332	APG9.1
AT5G65200		ATPUB38	ARABIDOPSIS THALIANA PLANT U-B...		Potri.015G071200 [exp]	35.70	0.7939
AT1G11240			unknown protein		Potri.004G035200 [exp]	38.67	0.7781
					Potri.004G206625 [exp]	42.10	0.8152

Compare expression of checked genes

Potri.008G113101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.