Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68765 47 / 4e-08 IDA INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) AT5G64667 37 / 0.0003 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1) AT3G25655 36 / 0.0004 IDL1 inflorescence deficient in abscission (IDA)-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G131500 [exp] 145 / 4e-47 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.005G189900 [exp] 41 / 7e-06 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 39 / 3e-05 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.007G110700 [exp] 38 / 7e-05 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.013G074000 [exp] 38 / 8e-05 AT1G68765 43 / 7e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.005G057400 [exp] 38 / 8e-05 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.016G134100 [exp] 37 / 0.0003 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034385 [exp] 94 / 1e-26 AT1G68765 44 / 5e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10034260 [exp] 91 / 3e-25 AT1G68765 44 / 6e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10005811 [exp] 41 / 1e-05 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1) Lus10020848 [exp] 36 / 0.0006 AT3G18715 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G114600.1 pacid=42805977 polypeptide=Potri.008G114600.1.p locus=Potri.008G114600 ID=Potri.008G114600.1.v4.1 annot-version=v4.1 ATGGCTACCTTTTCTTCCTCTTTTCAAGCTAAACTCCTTTCGTTCATTAACATCACAGGTGTTCTCTTTATCATATTCCTTCTTGTTAATTCTTGTTCTG CCACAAGACCGGGTGCTACTCTAATGAGGGACGAAGATATGTCAAAGAAATCGGAGTATATAAAGCCTCACCGGAGATTGTACGAGACAAGTTTTCGACA CCAGAACCACATATTCAACTTCTTGCCAAAAGGGGCCCCTATTCCACCTTCTGGTCCGTCCAAGAAACACAACTCAATAGAAAATTGA
AA sequence Show only first row Show all	>Potri.008G114600.1 pacid=42805977 polypeptide=Potri.008G114600.1.p locus=Potri.008G114600 ID=Potri.008G114600.1.v4.1 annot-version=v4.1 MATFSSSFQAKLLSFINITGVLFIIFLLVNSCSATRPGATLMRDEDMSKKSEYIKPHRRLYETSFRHQNHIFNFLPKGAPIPPSGPSKKHNSIEN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68765		IDA	INFLORESCENCE DEFICIENT IN ABS...		Potri.008G114600 [exp]	0	1
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Potri.011G048300 [exp]	4.35	0.9380
AT2G38830			Ubiquitin-conjugating enzyme/R...		Potri.002G046200 [exp]	5.47	0.9192
AT3G22560			Acyl-CoA N-acyltransferases (N...		Potri.008G154800 [exp]	5.74	0.9084
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Potri.011G048712 [exp]	6.78	0.9356
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Potri.011G049100 [exp]	7.74	0.9211
AT1G59590		ZCF37	ZCF37 (.1)		Potri.002G118200 [exp]	9.48	0.8640	ZCF37.1
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Potri.011G048100 [exp]	16.97	0.9199
					Potri.003G092900 [exp]	18.00	0.9127
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Potri.008G209300 [exp]	19.59	0.8789
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G170800 [exp]	20.73	0.9112

Compare expression of checked genes

Potri.008G114600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.