Plant FIBer expression Database

CLE12.2 (Potri.008G115600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol CLE12.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73965 68 / 7e-16 CLE13 CLAVATA3/ESR-RELATED 13 (.1)
AT1G68795 61 / 3e-13 CLE12 CLAVATA3/ESR-RELATED 12 (.1)
AT1G26600 47 / 1e-07 CLE9 CLAVATA3/ESR-RELATED 9 (.1)
AT1G69320 47 / 1e-07 CLE10 CLAVATA3/ESR-RELATED 10 (.1)
AT1G49005 45 / 3e-07 CLE11 CLAVATA3/ESR-RELATED 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G130400
[exp]
105 / 1e-30 AT1G68795 65 / 1e-14 CLAVATA3/ESR-RELATED 12 (.1)
Potri.012G059600
[exp]
67 / 2e-15 AT1G68795 59 / 3e-12 CLAVATA3/ESR-RELATED 12 (.1)
Potri.008G093500
[exp]
49 / 1e-08 AT1G69320 62 / 1e-13 CLAVATA3/ESR-RELATED 10 (.1)
Potri.010G160600
[exp]
47 / 1e-07 AT1G69320 48 / 1e-07 CLAVATA3/ESR-RELATED 10 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041496
[exp]
56 / 4e-11 AT1G68795 61 / 7e-13 CLAVATA3/ESR-RELATED 12 (.1)
Lus10034267
[exp]
54 / 4e-10 AT1G68795 59 / 7e-12 CLAVATA3/ESR-RELATED 12 (.1)
Lus10037107
[exp]
47 / 2e-07 AT1G73965 51 / 3e-09 CLAVATA3/ESR-RELATED 13 (.1)
Lus10036960
[exp]
47 / 2e-07 AT1G69320 52 / 1e-09 CLAVATA3/ESR-RELATED 10 (.1)
PFAM info
Representative CDS sequence
>Potri.008G115600.2 pacid=42806741 polypeptide=Potri.008G115600.2.p locus=Potri.008G115600 ID=Potri.008G115600.2.v4.1 annot-version=v4.1
ATGGCCTTGAAAATTTCTCACATTCCATGTGCCCTTCTTTGCCTCTACCTTCTCTTGCTAGCATTTCATGAGTTGCGTAATTTCAAGTCCAAGATCAACA
ACAACAAAGATCAAATCAACAACATAAGCAGTTCATCAATCTCTCATCACCCTTTCCACAATAGAAAAGTTCTTGTTAGCAAATTTGACTTCACCCCATT
CCAAAAACATCGTCAACAACAACATGAAAACCCTTTGCCTGATGAAGAGGTGCATAAGAAAGCAGCTCGAAGTGAGATTGATCCGCGTTATGGTGTCGAA
AAGCGCCTTGTCCCTACCGGTCCCAACCCGTTGCACCATTGA
AA sequence
>Potri.008G115600.2 pacid=42806741 polypeptide=Potri.008G115600.2.p locus=Potri.008G115600 ID=Potri.008G115600.2.v4.1 annot-version=v4.1
MALKISHIPCALLCLYLLLLAFHELRNFKSKINNNKDQINNISSSSISHHPFHNRKVLVSKFDFTPFQKHRQQQHENPLPDEEVHKKAARSEIDPRYGVE
KRLVPTGPNPLHH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73965 CLE13 CLAVATA3/ESR-RELATED 13 (.1) Potri.008G115600
[exp]
0 1 CLE12.2
AT1G51560 Pyridoxamine 5'-phosphate oxid... Potri.008G006400
[exp]
1.41 0.9190
AT3G57220 Glycosyl transferase family 4 ... Potri.006G045700
[exp]
2.82 0.9225
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Potri.003G093400
[exp]
3.87 0.9017
AT4G35190 LOG5 LONELY GUY 5, Putative lysine ... Potri.004G181800
[exp]
5.09 0.8954
AT5G61840 GUT1, IRX10-L Exostosin family protein (.1) Potri.012G109600
[exp]
7.21 0.9063
AT2G35880 TPX2 (targeting protein for Xk... Potri.016G066600
[exp]
8.66 0.9098
AT1G11040 HSP40/DnaJ peptide-binding pro... Potri.005G179400
[exp]
9.48 0.8991
AT4G17920 RING/U-box superfamily protein... Potri.003G093500
[exp]
9.79 0.8993
AT3G15620 UVR3 UV REPAIR DEFECTIVE 3, DNA pho... Potri.003G060000
[exp]
12.84 0.8930
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Potri.014G147000
[exp]
12.96 0.8999 Pt-RIC2.1

Potri.008G115600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.