Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13245 76 / 6e-21 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1) AT1G68825 68 / 1e-17 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT3G25717 62 / 2e-15 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1) AT1G67265 59 / 4e-14 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT5G16023 51 / 6e-11 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 (.1) AT3G55515 47 / 3e-09 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT3G02493 46 / 4e-09 DVL2, RTFL19, DVL12 DEVIL 2, ROTUNDIFOLIA like 19 (.1) AT2G36985 44 / 2e-08 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) AT4G13395 44 / 5e-08 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT2G39705 44 / 7e-08 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G129600 [exp] 89 / 4e-26 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.017G112100 [exp] 64 / 3e-16 AT1G67265 62 / 1e-15 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.004G102950 [exp] 62 / 3e-15 AT1G67265 64 / 4e-16 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.010G201700 [exp] 48 / 2e-09 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G057800 [exp] 48 / 2e-09 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G035900 [exp] 47 / 3e-09 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G226250 [exp] 46 / 4e-09 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.003G073900 [exp] 45 / 2e-08 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1) Potri.014G138900 [exp] 45 / 2e-08 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034272 [exp] 70 / 2e-18 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 60 / 3e-14 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10002705 [exp] 48 / 3e-09 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10023399 [exp] 47 / 8e-09 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10028393 [exp] 44 / 4e-08 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10041846 [exp] 42 / 3e-07 AT4G35783 59 / 1e-13 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10021966 [exp] 42 / 4e-07 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1) Lus10026526 [exp] 42 / 5e-07 AT2G36985 63 / 2e-15 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Lus10041259 [exp] 41 / 7e-07 AT1G53708 70 / 2e-17 ROTUNDIFOLIA like 9 (.1) Lus10040784 [exp] 42 / 8e-07 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.008G116700.1 pacid=42808076 polypeptide=Potri.008G116700.1.p locus=Potri.008G116700 ID=Potri.008G116700.1.v4.1 annot-version=v4.1 ATGAAGATGAACAGTGCTCGCATGGGGAGCTCAAAGAGAAGGATTTCAAGCAAAGGGCTAGGAGCTGTCCTTAGAGAACAAAGGGCTAGGCTTTACATAA TAAGGAGATGTGTAGTCATGTTAATATGCTGGCATGATTAA
AA sequence Show only first row Show all	>Potri.008G116700.1 pacid=42808076 polypeptide=Potri.008G116700.1.p locus=Potri.008G116700 ID=Potri.008G116700.1.v4.1 annot-version=v4.1 MKMNSARMGSSKRRISSKGLGAVLREQRARLYIIRRCVVMLICWHD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13245		RTFL17, DVL4	DEVIL 4, ROTUNDIFOLIA like 17 ...		Potri.008G116700 [exp]	0	1
AT5G47650		ATNUDX2, ATNUDT...	ARABIDOPSIS THALIANA NUDIX HYD...		Potri.001G368000 [exp]	1.73	0.8339
AT1G70940		PIN3, ATPIN3	ARABIDOPSIS PIN-FORMED 3, Auxi...		Potri.010G112800 [exp]	4.89	0.7734	PIN3.1,PIN3
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Potri.003G018800 [exp]	6.70	0.7592	Pt-AKT2.1
AT4G34200		EDA9	embryo sac development arrest ...		Potri.002G122700 [exp]	14.49	0.7617
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.012G035800 [exp]	18.76	0.8116
AT1G03170		FAF2	FANTASTIC FOUR 2, Protein of u...		Potri.005G209100 [exp]	24.16	0.7890
AT1G51340			MATE efflux family protein (.1...		Potri.009G053700 [exp]	27.12	0.7574
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Potri.006G127400 [exp]	32.31	0.7689
AT3G17510		CIPK1, SnRK3.16	SNF1-RELATED PROTEIN KINASE 3....		Potri.010G002500 [exp]	33.22	0.7460
AT1G73670		ATMPK15	MAP kinase 15 (.1)		Potri.010G112200 [exp]	33.31	0.7683

Compare expression of checked genes

Potri.008G116700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.