Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) AT1G34220 274 / 2e-87 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G35730 255 / 9e-82 Regulator of Vps4 activity in the MVB pathway protein (.1) AT2G19710 204 / 3e-59 Regulator of Vps4 activity in the MVB pathway protein (.1) AT4G29440 190 / 4e-54 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G13340 130 / 1e-34 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G79910 121 / 1e-31 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT2G14830 106 / 8e-26 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G52315 101 / 2e-24 Regulator of Vps4 activity in the MVB pathway protein (.1) AT4G32350 100 / 2e-23 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G117100 [exp] 276 / 8e-89 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.019G087400 [exp] 269 / 5e-86 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.007G059800 [exp] 240 / 7e-76 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.006G149800 [exp] 230 / 3e-68 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.017G113900 [exp] 147 / 4e-42 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.010G127000 [exp] 145 / 3e-40 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.004G100900 [exp] 148 / 4e-40 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.013G135700 [exp] 132 / 2e-34 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.004G038600 [exp] 115 / 2e-28 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041442 [exp] 299 / 2e-101 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Lus10028724 [exp] 267 / 3e-86 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10006061 [exp] 266 / 7e-86 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10034330 [exp] 247 / 2e-80 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Lus10041836 [exp] 230 / 3e-72 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10028383 [exp] 226 / 7e-71 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10000978 [exp] 221 / 6e-65 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10040542 [exp] 215 / 8e-63 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041468 [exp] 154 / 2e-43 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10034303 [exp] 152 / 1e-42 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03398 [poplar] [flax] Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence Show only first row Show all	>Potri.008G121300.1 pacid=42807163 polypeptide=Potri.008G121300.1.p locus=Potri.008G121300 ID=Potri.008G121300.1.v4.1 annot-version=v4.1 ATGTCCCTCTTAAACCAACTCTTCAACAGAGGCGTTTTTGGTTCTAAATGCAAAACATGCTTGAACTTGGCAATCTCGCGCATTAAATTGCTGCAAAACA AGAGAGATTTGCAGCTTAAACACATGCGCAAGGAGATTGCGCAATTTCTTCAGGCTGGCCAAGAAGCAATTGCTCGAATTCGGGTGGAGCATGTAATACG AGAACAAAATATACGGGCTGCTTATGAGATACTGGAGCTGTTCTGTGAGTTTGTTCTTGTGCGTGTTCCGATTCTTGAAAGTCAAAAGGAATGTCCAGCT GAATTACGAGAGGCTATTGCAAGCATAATTTTTGCTGCTCCAAGATGTTCAGAAGTGCCAGATTTGCTGCAGATCAAGAATTTGTTTGCTGCAAAATATG GAAAGGAATTCAACATGGCTGCATCTGAGCTCCGTCCTGATTCTGGTGTCAACCGTGCAATTATTGAAAGGCTTTCAGTTAGAGCTCCACCAGCAGAGGC AAGGCTCAAGGTTTTGAAGGAAATCGCTCAAGAATTTAGTCTTGAGTGGGACTCTTCTAACACAGAGGCTGAACTCGGGAAAAAGCATGAAGATTTGCTG GGTGGATCAAAGGAAATTATGGCTGATGCAATACTTCCTCAAGCACCCACCAAACAGAACTCTCCTCTATCCCCACCTTCCAACGGGGCCCATTCTACCT TAAATACGGATAATAAGCAAGGATCGCATCGTCTTGAAGCTCCTGCGCTTGTGAGCAATATGCCCCGGGTCAATGCTAACGAAATTGAACCATCAATCAG GAATTACATGGCTGATGTTCAAAGGGAGACAACATCTCAATCATCTGATGTCTTGGAGAGAGCTCGAGTCGCCATTGCATCAGCAGAGCGTGCAACTATT GCTGCCCGTGCAGCTGCTGAACTTGTAAATGTTCAATTTGGTTAA
AA sequence Show only first row Show all	>Potri.008G121300.1 pacid=42807163 polypeptide=Potri.008G121300.1.p locus=Potri.008G121300 ID=Potri.008G121300.1.v4.1 annot-version=v4.1 MSLLNQLFNRGVFGSKCKTCLNLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIARIRVEHVIREQNIRAAYEILELFCEFVLVRVPILESQKECPA ELREAIASIIFAAPRCSEVPDLLQIKNLFAAKYGKEFNMAASELRPDSGVNRAIIERLSVRAPPAEARLKVLKEIAQEFSLEWDSSNTEAELGKKHEDLL GGSKEIMADAILPQAPTKQNSPLSPPSNGAHSTLNTDNKQGSHRLEAPALVSNMPRVNANEIEPSIRNYMADVQRETTSQSSDVLERARVAIASAERATI AARAAAELVNVQFG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G25420			Regulator of Vps4 activity in ...		Potri.008G121300 [exp]	0	1
AT1G27000			Protein of unknown function (D...		Potri.010G092700 [exp]	1.00	0.8005
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.006G240900 [exp]	1.73	0.7276
AT5G03290		IDH-V	isocitrate dehydrogenase V (.1...		Potri.006G126700 [exp]	4.24	0.7385
AT2G16710			Iron-sulphur cluster biosynthe...		Potri.008G020400 [exp]	8.48	0.6690
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	9.16	0.7070
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.004G160300 [exp]	9.79	0.6691	RD19.3
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.005G243100 [exp]	13.74	0.6717	Pt-SKP1.3
AT4G00355		ATI2	ATG8-interacting protein 2, un...		Potri.014G086000 [exp]	14.49	0.6580
AT4G09830			Uncharacterised conserved prot...		Potri.002G064800 [exp]	21.63	0.6479
AT3G01170			Ribosomal protein L34e superfa...		Potri.004G121900 [exp]	26.38	0.5931

Compare expression of checked genes

Potri.008G121300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.