Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G25930 107 / 4e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 104 / 2e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 101 / 1e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 99 / 2e-26 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 86 / 1e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 85 / 3e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 71 / 1e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 70 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G17020 66 / 6e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G112300 [exp] 177 / 3e-57 AT1G68300 113 / 3e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 174 / 6e-56 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123300 [exp] 168 / 6e-54 AT3G25930 104 / 5e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 159 / 2e-50 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 154 / 2e-48 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 109 / 2e-30 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 99 / 2e-26 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 99 / 5e-26 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.005G015200 [exp] 94 / 9e-25 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034337 [exp] 149 / 3e-46 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 146 / 3e-45 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 98 / 3e-26 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 96 / 1e-25 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 95 / 3e-24 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 95 / 5e-23 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10009272 [exp] 84 / 2e-20 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 82 / 7e-20 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10006703 [exp] 70 / 1e-15 AT2G47710 169 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025033 [exp] 71 / 3e-15 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G121800.1 pacid=42805732 polypeptide=Potri.008G121800.1.p locus=Potri.008G121800 ID=Potri.008G121800.1.v4.1 annot-version=v4.1 ATGAATAAAGAAAATGGAAGGGCTAATATGAAGGTGATGGTGGTCATAGATGAAAGTGAGTGCAGTTATCGTGCTCTTATGTGGGTGCTCGACAATCTCA AAGAATCGATCAAGAACTTACCGCTTGTCATATTCGCAGCGCAGCCACCTCCAAAATGTAATTATGTAGTCTCTTCAGCATTTGGTCCCGCTTGCATATG TCCACTCTCAGCCACCATGGATCTATTTAACTCTGTTCAACAACAAAATAAGAAGGTGGCATTGGGTATTCTGGAGAAGGCTAAGAGAATATGTGCAAGT AAAGGGGTAACTGTGGAGGCAATTACTGAGGCGGGTTATCCTAAAGAGGTCATATGCGATGCAGTTCAGAAGTGTGGTGTCAGTTTACTTGTCATTGGCG ACGAGGCAAATGGAAATATCAAGAGGGCTTTGCTGGGAAGTGTCAGCAGTTACTGCGTTCAGAATGCCAAGTGCCAGGTTCTTCTTGTGAGAAACAAGGC CTGA
AA sequence Show only first row Show all	>Potri.008G121800.1 pacid=42805732 polypeptide=Potri.008G121800.1.p locus=Potri.008G121800 ID=Potri.008G121800.1.v4.1 annot-version=v4.1 MNKENGRANMKVMVVIDESECSYRALMWVLDNLKESIKNLPLVIFAAQPPPKCNYVVSSAFGPACICPLSATMDLFNSVQQQNKKVALGILEKAKRICAS KGVTVEAITEAGYPKEVICDAVQKCGVSLLVIGDEANGNIKRALLGSVSSYCVQNAKCQVLLVRNKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68300			Adenine nucleotide alpha hydro...		Potri.008G121800 [exp]	0	1
AT3G60580	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.002G143800 [exp]	8.48	0.8232
AT1G14190			Glucose-methanol-choline (GMC)...		Potri.010G168200 [exp]	9.53	0.8412
AT2G26490			Transducin/WD40 repeat-like su...		Potri.014G038400 [exp]	18.33	0.7622
					Potri.007G093850 [exp]	21.16	0.7904
AT3G22750			Protein kinase superfamily pro...		Potri.002G049700 [exp]	22.13	0.8142
ATCG00160		ATCG00160.1, RP...	ribosomal protein S2 (.1)		Potri.019G028700 [exp]	23.23	0.8540
AT5G40990		GLIP1	GDSL lipase 1 (.1)		Potri.017G134350 [exp]	25.19	0.7582
AT5G52340		ATEXO70A2	exocyst subunit exo70 family p...		Potri.006G203900 [exp]	30.33	0.7618
ATCG00160		ATCG00160.1, RP...	ribosomal protein S2 (.1)		Potri.013G139670 [exp]	33.22	0.8495
ATCG00170		ATCG00170.1, RP...	DNA-directed RNA polymerase fa...		Potri.019G027720 [exp]	35.79	0.8464

Compare expression of checked genes

Potri.008G121800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.