Plant FIBer expression Database

Potri.008G122450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G147700
[exp]
69 / 3e-15 AT1G70280 568 / 0.0 NHL domain-containing protein (.1.2)
Potri.009G072933
[exp]
60 / 1e-13 AT1G23880 44 / 7e-07 NHL domain-containing protein (.1)
Potri.010G094200
[exp]
59 / 9e-12 AT1G70280 511 / 5e-179 NHL domain-containing protein (.1.2)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G122450.1 pacid=42808401 polypeptide=Potri.008G122450.1.p locus=Potri.008G122450 ID=Potri.008G122450.1.v4.1 annot-version=v4.1
ATGAGTGAAACGGGGAAGAATGTGCTGGTGTTGTGTCACTTCAGTTCCCACAATTACTTCACCAGCGAAGATTGTTGGTGGGTTTTTCTCAAATGTCGTG
TCTGCTCTCATGAAGTGGCTGTGGTCTCTGAAAGCCACTACCAAAACAGGTTTGAATCTCTGAATCTACTACCACATTTGCTCCTTTTGTTCTGTTCTGT
TCTGTTTGTTTGCTGGTTTTGGGCTTATGAAATTTTCGAAGGTAGTGATCTCTGGTCGTCCAATGAAGAAGTTTGA
AA sequence
>Potri.008G122450.1 pacid=42808401 polypeptide=Potri.008G122450.1.p locus=Potri.008G122450 ID=Potri.008G122450.1.v4.1 annot-version=v4.1
MSETGKNVLVLCHFSSHNYFTSEDCWWVFLKCRVCSHEVAVVSESHYQNRFESLNLLPHLLLLFCSVLFVCWFWAYEIFEGSDLWSSNEEV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23880 NHL domain-containing protein ... Potri.008G122450
[exp]
0 1
AT1G76210 Arabidopsis protein of unknown... Potri.002G012600
[exp]
5.00 0.6630
AT3G54010 DEI1, PAS1 PASTICCINO 1, FKBP-type peptid... Potri.006G093101
[exp]
10.77 0.5613
Potri.002G118950
[exp]
20.17 0.5346
AT4G08690 Sec14p-like phosphatidylinosit... Potri.005G168100
[exp]
30.65 0.5181
AT3G57770 Protein kinase superfamily pro... Potri.005G106600
[exp]
33.49 0.5222
Potri.015G055951
[exp]
33.98 0.4867
Potri.006G031300
[exp]
46.79 0.5100
AT1G74000 SS3 strictosidine synthase 3 (.1) Potri.015G037700
[exp]
54.96 0.4858
Potri.010G084600
[exp]
55.99 0.5260
AT1G79400 ATCHX2 cation/H+ exchanger 2, cation/... Potri.003G194100
[exp]
59.83 0.4359 ATCHX1.2

Potri.008G122450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.