Potri.008G124200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11220 138 / 1e-40 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
AT4G23630 132 / 3e-38 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
AT2G46170 130 / 1e-37 Reticulon family protein (.1.2)
AT1G64090 121 / 4e-34 RTNLB3 Reticulan like protein B3 (.1.2)
AT5G41600 121 / 5e-34 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
AT3G61560 117 / 2e-32 Reticulon family protein (.1.2)
AT1G68230 105 / 4e-29 Reticulon family protein (.1.2)
AT3G18260 105 / 2e-28 Reticulon family protein (.1)
AT3G10260 103 / 2e-27 Reticulon family protein (.1.2.3)
AT2G15280 88 / 9e-22 Reticulon family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G035600 133 / 1e-38 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.001G097700 130 / 1e-37 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.015G027300 129 / 5e-37 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.014G091200 127 / 3e-36 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2)
Potri.012G054100 125 / 5e-36 AT3G18260 238 / 6e-80 Reticulon family protein (.1)
Potri.003G133600 123 / 7e-35 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.002G055600 122 / 1e-34 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
Potri.002G165400 121 / 4e-34 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2)
Potri.015G044300 117 / 1e-32 AT3G18260 251 / 1e-84 Reticulon family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032451 135 / 8e-40 AT3G18260 268 / 9e-92 Reticulon family protein (.1)
Lus10014948 128 / 9e-37 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Lus10032313 126 / 1e-35 AT4G23630 318 / 1e-109 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Lus10027548 125 / 1e-35 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2)
Lus10038833 124 / 2e-35 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
Lus10041080 124 / 5e-35 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2)
Lus10036405 123 / 1e-34 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2)
Lus10027546 121 / 4e-34 AT4G11220 307 / 5e-106 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
Lus10028753 126 / 1e-33 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10029822 117 / 2e-32 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF02453 Reticulon Reticulon
Representative CDS sequence
>Potri.008G124200.2 pacid=42807630 polypeptide=Potri.008G124200.2.p locus=Potri.008G124200 ID=Potri.008G124200.2.v4.1 annot-version=v4.1
ATGAGAAGTGACATGCATGCCGTCCTTGGACGGGGAAAGGTTGCTGACATATTGTCGTGGAAGAACAAGACATTATCAGGAGGGATCCTAGGGGGTGTTA
CTGTTCTATGGGTTCTCTTTGAACTTACAGGGTACTCTTTAGCAACCTTCTTCTGTCACATTCTCATGCTTTTGATGATCACCCTCTTCACCTGGTCCAA
GAGTGCAGGACTCACCAAAAGGAATCCTCCTACTTCTAACGATATAAGGTTGCCAGAATCAGCATTCAGATTCTTCTTTGATCAAATTAACGAGACTATA
CTTGCATTTTACAAAACATCAACGGGCCAGAAAGGTTTAAAAACCTTTTTTGTGACATTAGCTGGGCTTTACATCTTGTCATTTATTGGATCCCTATTCA
GCACCATGACCTTTGCATACCTTGTCTTTGCCTGCTGTGCGACAATACCAGCTTTCTATGAGCAAAATAAGATGCAGGTGCATGAAATTTTTGGGCAAAG
CTACAGAGAAATAAACAACTCATTGAAAGATTTCAGGTCCAAACTCTTTGACAAGATTCCAAGAGGAAAAGATGACTAG
AA sequence
>Potri.008G124200.2 pacid=42807630 polypeptide=Potri.008G124200.2.p locus=Potri.008G124200 ID=Potri.008G124200.2.v4.1 annot-version=v4.1
MRSDMHAVLGRGKVADILSWKNKTLSGGILGGVTVLWVLFELTGYSLATFFCHILMLLMITLFTWSKSAGLTKRNPPTSNDIRLPESAFRFFFDQINETI
LAFYKTSTGQKGLKTFFVTLAGLYILSFIGSLFSTMTFAYLVFACCATIPAFYEQNKMQVHEIFGQSYREINNSLKDFRSKLFDKIPRGKDD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G11220 RTNLB2, BTI2 Reticulan like protein B2, VIR... Potri.008G124200 0 1

Potri.008G124200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.