Potri.008G125350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G125350.1 pacid=42807296 polypeptide=Potri.008G125350.1.p locus=Potri.008G125350 ID=Potri.008G125350.1.v4.1 annot-version=v4.1
ATGATTTCATCCACCCATCGTATGAATCATGTTGGGGTCATCCATACTAGAAGAAACGCGTGGACAGATGCTCAAAATAAATTCCAAATTCAAAGAACAA
ATCAAGGAACATCAGAGCTAATTAAGCACTGCAGTATAGAACTAACTGAGACAGCATCCCCGGAATCGAAGAGGCGCGAACAGATATGTTGTGAATATCA
CAGTTGTCATTTCAAAACACATGATTTATCAGTTGCTAATATTAAATCTAGCTGTATTGACAAATGA
AA sequence
>Potri.008G125350.1 pacid=42807296 polypeptide=Potri.008G125350.1.p locus=Potri.008G125350 ID=Potri.008G125350.1.v4.1 annot-version=v4.1
MISSTHRMNHVGVIHTRRNAWTDAQNKFQIQRTNQGTSELIKHCSIELTETASPESKRREQICCEYHSCHFKTHDLSVANIKSSCIDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G125350 0 1
AT4G30240 Syntaxin/t-SNARE family protei... Potri.018G093400 2.82 0.8714
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Potri.005G133700 2.82 0.8672
AT5G16520 unknown protein Potri.013G087400 8.48 0.8327
AT1G49120 AP2_ERF CRF9 cytokinin response factor 9, I... Potri.015G054500 8.77 0.7760
AT2G38450 unknown protein Potri.008G075000 19.89 0.8500
Potri.003G152701 22.18 0.8420
Potri.013G126650 23.23 0.8357
AT3G47570 Leucine-rich repeat protein ki... Potri.010G228300 23.91 0.8408
Potri.009G036201 26.26 0.8170
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Potri.012G048600 27.82 0.7514

Potri.008G125350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.