Potri.008G128301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35040 82 / 5e-20 AICARFT/IMPCHase bienzyme family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G114400 87 / 2e-21 AT2G35040 992 / 0.0 AICARFT/IMPCHase bienzyme family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013871 87 / 1e-21 AT2G35040 989 / 0.0 AICARFT/IMPCHase bienzyme family protein (.1.2)
Lus10014374 86 / 3e-21 AT2G35040 945 / 0.0 AICARFT/IMPCHase bienzyme family protein (.1.2)
Lus10023871 84 / 1e-20 AT2G35040 976 / 0.0 AICARFT/IMPCHase bienzyme family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.008G128301.1 pacid=42806603 polypeptide=Potri.008G128301.1.p locus=Potri.008G128301 ID=Potri.008G128301.1.v4.1 annot-version=v4.1
ATGAGGATGATCAACAGTTCCGGAGAAAGCTTGCTTGGAAGGCTTTTCAACATTGTGCTTCCTATGATTCTGCAGTTTCAGAGTGGCTGTGGAAACAAAC
TGTGGGGGGCTTGGAACGATGCAGTGGAAGAGGCATGTGAAGCTGGTGTTGGTGTTATCGCAGAGCCTGGTGGGAGGAGCATCAGGGATAAGGATGCCAT
AGACTGCTGCAACAAGCATGGGGTTTCGCTGTTTTTCACCAATGTCCTTTAG
AA sequence
>Potri.008G128301.1 pacid=42806603 polypeptide=Potri.008G128301.1.p locus=Potri.008G128301 ID=Potri.008G128301.1.v4.1 annot-version=v4.1
MRMINSSGESLLGRLFNIVLPMILQFQSGCGNKLWGAWNDAVEEACEAGVGVIAEPGGRSIRDKDAIDCCNKHGVSLFFTNVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35040 AICARFT/IMPCHase bienzyme fami... Potri.008G128301 0 1
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.014G163301 6.00 0.7028
Potri.010G224650 11.48 0.6138
AT1G22110 structural constituent of ribo... Potri.005G169900 15.71 0.5574
AT4G30390 unknown protein Potri.019G051850 19.07 0.5436
Potri.009G159650 28.72 0.5597
AT2G18950 ATHPT, VTE2, TP... VITAMIN E 2, homogentisate phy... Potri.018G022000 28.84 0.5129
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Potri.004G023550 28.98 0.5336
AT5G28780 PIF1 helicase (.1) Potri.009G002650 33.22 0.6331
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.012G072500 36.20 0.4825 Pt-MYB.54,MYB198
AT1G09060 Zinc finger, RING-type;Transcr... Potri.005G026950 43.12 0.4799

Potri.008G128301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.