Plant FIBer expression Database

Potri.008G129100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23040 41 / 7e-05 hydroxyproline-rich glycoprotein family protein (.1)
AT1G70990 41 / 8e-05 proline-rich family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G113300
[exp]
49 / 5e-08 AT1G23040 42 / 2e-05 hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G129100.1 pacid=42807791 polypeptide=Potri.008G129100.1.p locus=Potri.008G129100 ID=Potri.008G129100.1.v4.1 annot-version=v4.1
ATGCTGCTAGAAATGAGTTTTTTCAACTCTTTTATGCTATTAAGTTTGCTTCTTTTTGTTGTGGCTCCGGTTCATGGCTTAAATTTAAGGAAGCTTGATG
AGACCACTGTTCCTGGACCGACTGAAGAGAAGTGCTCGCCATGTAATCCAAGTCCTCCACCACCGTCACTTCCACCAGTAGTATATCCCTCACCACCACC
ACCATCACCACCTCCACCATCACCAGTATTATACCCCCCACCACCACCTGCACCAGTGCTGCCACCACCGACTCCAAAGAAGCCGCCATCAGGTTACAAC
TGCCCTCCACCTCCAGCCCCATCAAAATATGATCTTTACATAACTGGTCCACCAGGGGAATTGTACCCTGTTGACAAAGATGTCAATGCTGCTAGCCGCC
ATGCCGTGAGTTTGCAAGTTTTGATTGGATGTGGATTGATAGGCTTGTTGGTAAGAATTGGCTTTTAA
AA sequence
>Potri.008G129100.1 pacid=42807791 polypeptide=Potri.008G129100.1.p locus=Potri.008G129100 ID=Potri.008G129100.1.v4.1 annot-version=v4.1
MLLEMSFFNSFMLLSLLLFVVAPVHGLNLRKLDETTVPGPTEEKCSPCNPSPPPPSLPPVVYPSPPPPSPPPPSPVLYPPPPPAPVLPPPTPKKPPSGYN
CPPPPAPSKYDLYITGPPGELYPVDKDVNAASRHAVSLQVLIGCGLIGLLVRIGF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23040 hydroxyproline-rich glycoprote... Potri.008G129100
[exp]
0 1
AT1G23050 hydroxyproline-rich glycoprote... Potri.008G129200
[exp]
1.00 0.7075
AT1G04990 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Potri.014G159500
[exp]
4.47 0.6849 Pt-ZFN2.1
AT1G61260 Protein of unknown function (D... Potri.001G406600
[exp]
8.36 0.6622
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Potri.016G071500
[exp]
8.94 0.6469 NHL1.1
AT3G23290 LSH4 LIGHT SENSITIVE HYPOCOTYLS 4, ... Potri.008G167700
[exp]
12.68 0.6051
AT1G22610 C2 calcium/lipid-binding plant... Potri.013G107700
[exp]
18.70 0.6604
AT2G39050 ArathEULS3 Euonymus lectin S3, hydroxypro... Potri.019G031500
[exp]
27.38 0.6763
AT5G50720 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOM... Potri.012G101600
[exp]
31.63 0.6328
AT4G16380 Heavy metal transport/detoxifi... Potri.016G006700
[exp]
33.40 0.6408
AT3G66654 Cyclophilin-like peptidyl-prol... Potri.010G144500
[exp]
33.88 0.5829

Potri.008G129100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.