Potri.008G129200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23050 50 / 2e-08 hydroxyproline-rich glycoprotein family protein (.1)
AT1G70985 47 / 4e-07 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G113100 82 / 8e-21 AT1G70985 / hydroxyproline-rich glycoprotein family protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G129200.1 pacid=42807721 polypeptide=Potri.008G129200.1.p locus=Potri.008G129200 ID=Potri.008G129200.1.v4.1 annot-version=v4.1
ATGGATATTAACTTAACCCTAACTCTCTCCATCCTCTTCTTCACATCCGTACTTTCCAATCTTCCTAGCTTGGCCACTTCCGACGACGTGTGCCCTTATC
CTTGTTATCCTCCTCCCACGGGGACCGGCCGTACCCCAACAGTACTGACAACACCGCCGTCTCCTCCATCTCAGTCAGCAGGATCATACTCGCCTCCTGG
ATACCCTTCTCCGACTGGGAATTTACCATTCTACCCTCCTCCACCTTTTGGCAACAACTTGGATGGTCTTTCACCTCCTGACCCTATCTTGCCTTATTTC
CCATTCTACTACAGGAAGCCTCCTCATCAAACTGACGCGTCTTTGGCAACCAATAGTCTTCCAACTCTCATGATGGCCGCAATATCTAATATTCTTGCTT
TCGCTTTTCTGCATCTCGTTTTTGGTTGTTGA
AA sequence
>Potri.008G129200.1 pacid=42807721 polypeptide=Potri.008G129200.1.p locus=Potri.008G129200 ID=Potri.008G129200.1.v4.1 annot-version=v4.1
MDINLTLTLSILFFTSVLSNLPSLATSDDVCPYPCYPPPTGTGRTPTVLTTPPSPPSQSAGSYSPPGYPSPTGNLPFYPPPPFGNNLDGLSPPDPILPYF
PFYYRKPPHQTDASLATNSLPTLMMAAISNILAFAFLHLVFGC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23050 hydroxyproline-rich glycoprote... Potri.008G129200 0 1
AT1G23040 hydroxyproline-rich glycoprote... Potri.008G129100 1.00 0.7075
AT1G22610 C2 calcium/lipid-binding plant... Potri.013G107700 6.63 0.7053
AT2G04780 FLA7 FASCICLIN-like arabinoogalacta... Potri.014G162900 11.35 0.6635
AT3G60200 unknown protein Potri.014G043800 13.41 0.6609
AT5G65170 VQ motif-containing protein (.... Potri.005G166100 14.28 0.6633
AT1G30760 FAD-binding Berberine family p... Potri.001G462800 16.00 0.6404
AT4G34940 ARO1 armadillo repeat only 1 (.1) Potri.009G131900 19.59 0.6049
AT5G47820 FRA1 FRAGILE FIBER 1, P-loop contai... Potri.002G123500 24.97 0.6495
AT4G16380 Heavy metal transport/detoxifi... Potri.016G006700 36.33 0.6235
AT3G23290 LSH4 LIGHT SENSITIVE HYPOCOTYLS 4, ... Potri.008G167700 38.07 0.5569

Potri.008G129200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.