Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	MLP.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70890 107 / 3e-30 MLP43 MLP-like protein 43 (.1) AT5G28010 100 / 2e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70830 99 / 5e-27 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G70840 97 / 4e-26 MLP31 MLP-like protein 31 (.1) AT1G70850 96 / 5e-25 MLP34 MLP-like protein 34 (.1.2.3) AT3G26460 94 / 6e-25 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G01520 92 / 3e-24 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) AT4G23680 92 / 3e-24 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70880 91 / 6e-24 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 91 / 9e-24 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131200 [exp] 162 / 5e-52 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131300 [exp] 123 / 9e-37 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G111000 [exp] 101 / 5e-28 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051100 [exp] 99 / 4e-27 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 79 / 2e-19 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G096000 [exp] 69 / 3e-15 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2) Potri.004G051500 [exp] 56 / 3e-10 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028887 [exp] 146 / 1e-45 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) Lus10008930 [exp] 139 / 8e-43 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008932 [exp] 139 / 1e-41 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10033397 [exp] 136 / 1e-41 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042489 [exp] 127 / 3e-38 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 124 / 5e-37 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10020498 [exp] 84 / 3e-21 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10020497 [exp] 82 / 4e-20 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10012466 [exp] 80 / 2e-19 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012742 [exp] 77 / 2e-18 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.008G131100.2 pacid=42808453 polypeptide=Potri.008G131100.2.p locus=Potri.008G131100 ID=Potri.008G131100.2.v4.1 annot-version=v4.1 ATGTCTCTAAAGGGTGAGCTGGAGACTGTCATAGAACTCAAATCCTCTCCTGAGAAGTTCTTCGGTGTCTGGAAGACCCAAGCCTATCATATCCCCAACC ACACTCCTGACAATATCCATGCAGTTGATATGCATGAAGGTGAATGGGAAACTGAGGGTTCTATCAAGATCTGGAGGTACAGCGTAGATGGAAAACAGGA GGTCTTTAAAGAGAAGGTGGTAGTGGATGAAGAAAAGAACACACTGGCTCTCACTGGCCTGGAAGGAGATGTCATGACTAGATACAAAATATTCAATCCC ACCTATCATCTTACACCAAAAGATGATGGAAGCTTGGCCAGGCTGATCATTGAATATGAGAAACTGAACGAGAATATCCCAGTCCCAGACAAGTACATGG ATTTCATGATAACTGTTACCAAAGATATCGATGCAAGTCTTACGAAGGCATAA
AA sequence Show only first row Show all	>Potri.008G131100.2 pacid=42808453 polypeptide=Potri.008G131100.2.p locus=Potri.008G131100 ID=Potri.008G131100.2.v4.1 annot-version=v4.1 MSLKGELETVIELKSSPEKFFGVWKTQAYHIPNHTPDNIHAVDMHEGEWETEGSIKIWRYSVDGKQEVFKEKVVVDEEKNTLALTGLEGDVMTRYKIFNP TYHLTPKDDGSLARLIIEYEKLNENIPVPDKYMDFMITVTKDIDASLTKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70890		MLP43	MLP-like protein 43 (.1)		Potri.008G131100 [exp]	0	1	MLP.2
AT1G70830		MLP28	MLP-like protein 28 (.1.2.3.4....		Potri.010G111000 [exp]	1.00	0.9723	MLP43.1
AT1G14930			Polyketide cyclase/dehydrase a...		Potri.008G131200 [exp]	2.44	0.9334	MLP.3
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Potri.009G114600 [exp]	3.46	0.9298
					Potri.004G112600 [exp]	4.24	0.9174
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.003G007900 [exp]	4.89	0.9423
AT1G10480	C2H2ZnF	ZFP5	zinc finger protein 5 (.1)		Potri.010G036400 [exp]	10.09	0.9234	Pt-ZFP5.2
AT1G52140			unknown protein		Potri.001G188900 [exp]	11.18	0.9234
AT2G47260	WRKY	ATWRKY23, WRKY2...	WRKY DNA-binding protein 23 (....		Potri.002G193000 [exp]	14.49	0.9135	Pt-WRKY48.2
AT4G14465	AT-hook	AHL20	AT-hook motif nuclear-localize...		Potri.010G074201 [exp]	15.87	0.9229
					Potri.009G114701 [exp]	17.32	0.9013

Compare expression of checked genes

Potri.008G131100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.