Potri.008G131550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23149 36 / 4e-05 CPuORF29 conserved peptide upstream open reading frame 29 (.1)
AT1G70782 35 / 9e-05 CPuORF28 conserved peptide upstream open reading frame 28 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G110850 56 / 9e-13 AT1G23149 37 / 3e-05 conserved peptide upstream open reading frame 29 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G131550.1 pacid=42808256 polypeptide=Potri.008G131550.1.p locus=Potri.008G131550 ID=Potri.008G131550.1.v4.1 annot-version=v4.1
ATGGTGGAAATCTTAAGTAGTAGTAATTACATGCTCTCCCTTTGTCGATCAAGGGCGGGCGTTGTCTCTGTGGCCTCTGCTTTTGCTTTCGGATCTTGCA
AGGAAGGCTGGTACTATCGTTGCATCGGTGTCGACCCGTAA
AA sequence
>Potri.008G131550.1 pacid=42808256 polypeptide=Potri.008G131550.1.p locus=Potri.008G131550 ID=Potri.008G131550.1.v4.1 annot-version=v4.1
MVEILSSSNYMLSLCRSRAGVVSVASAFAFGSCKEGWYYRCIGVDP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23149 CPuORF29 conserved peptide upstream ope... Potri.008G131550 0 1
AT1G70780 unknown protein Potri.008G131600 1.00 0.8225
AT2G43020 ATPAO2 polyamine oxidase 2 (.1) Potri.005G207300 1.41 0.7812
AT4G29810 MK1, ATMKK2 MAP KINASE KINASE 1, MAP kinas... Potri.018G050800 5.65 0.6608 Pt-MEK1.2
AT1G10740 alpha/beta-Hydrolases superfam... Potri.010G044400 7.41 0.6960
AT1G10040 alpha/beta-Hydrolases superfam... Potri.002G113000 14.59 0.7434
AT1G31830 Amino acid permease family pro... Potri.004G178000 18.27 0.5787
AT1G60810 ACLA-2 ATP-citrate lyase A-2 (.1) Potri.008G188900 26.87 0.6584 Pt-ACLA.1
AT1G30760 FAD-binding Berberine family p... Potri.011G161300 28.46 0.6713
AT5G67050 alpha/beta-Hydrolases superfam... Potri.007G044500 29.39 0.6966
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Potri.006G272700 32.72 0.6768

Potri.008G131550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.