Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14890 216 / 2e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 214 / 1e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G23205 189 / 8e-61 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 179 / 7e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 148 / 6e-45 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 144 / 4e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 134 / 1e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 134 / 3e-39 PME1 pectin methylesterase inhibitor 1 (.1) AT1G62770 133 / 5e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 132 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G109300 [exp] 315 / 2e-110 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 150 / 1e-45 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 141 / 4e-42 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 139 / 2e-41 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128300 [exp] 138 / 4e-41 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 137 / 1e-40 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128900 [exp] 127 / 9e-37 AT4G25250 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 125 / 5e-36 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G129400 [exp] 125 / 8e-36 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038645 [exp] 238 / 1e-79 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 143 / 6e-43 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 139 / 3e-41 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 137 / 1e-40 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 134 / 2e-39 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 132 / 2e-38 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 129 / 2e-37 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 126 / 4e-36 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10028910 [exp] 122 / 1e-34 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031712 [exp] 120 / 4e-34 AT5G51520 149 / 2e-45 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.008G132600.1 pacid=42806304 polypeptide=Potri.008G132600.1.p locus=Potri.008G132600 ID=Potri.008G132600.1.v4.1 annot-version=v4.1 ATGCCATCAGAAACGCCAGGCCCTCTGCTACTCTTCACCTTCTTCCTAACAACCTTCCTTCTCTATTCCCAACCAATCTCAACCGTCGCTTCACCGGACA CCGGCTTTTCTCAATCCAGCGGCACAGATTACATTCGCTCAAGCTGCGGCGCAACATTGTACCCCGAAATCTGCTACACCTCCCTCTCTCGCTACGCCAG CGCTGTAAAACAAAGCCCCAGTCGCCTAGCTCGCGTGGCCATCGGCGTCAGCCTCTCAAGAGCACGCCGCCTGGCAGCCTACGTATCCAACCTAACCCGC CATGAAGACTTCGGAGGCGATCACCGTGCCACGGCCGCCATTCACGACTGCTTATCCAACATGGGAGACGCCGTTGATGAGATGAGTGGGTCGTTGAAGC AGATGCGGAAAGTTGGAGCAGCTGGGCTGTCGGCAGAGTCGTTTCAGTTTCAGATGAGTAACGTGCAGACGTGGATGAGTGCGGCTTTGACAGATGAGGA GACGTGTACGGATGGATTTGAGGATGTAGCGGACGGGGCTGTGAAAACGGAGGTGTGTAACCGTGTTGCGGATGCCAAGAAATTTACTAGCAATGCTCTT GCTCTGGTTAACACTTTTGCTGCCGCAGGAACGCCATGA
AA sequence Show only first row Show all	>Potri.008G132600.1 pacid=42806304 polypeptide=Potri.008G132600.1.p locus=Potri.008G132600 ID=Potri.008G132600.1.v4.1 annot-version=v4.1 MPSETPGPLLLFTFFLTTFLLYSQPISTVASPDTGFSQSSGTDYIRSSCGATLYPEICYTSLSRYASAVKQSPSRLARVAIGVSLSRARRLAAYVSNLTR HEDFGGDHRATAAIHDCLSNMGDAVDEMSGSLKQMRKVGAAGLSAESFQFQMSNVQTWMSAALTDEETCTDGFEDVADGAVKTEVCNRVADAKKFTSNAL ALVNTFAAAGTP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14890			Plant invertase/pectin methyle...		Potri.008G132600 [exp]	0	1
AT1G12845			unknown protein		Potri.017G060400 [exp]	2.82	0.8175
AT5G53880			unknown protein		Potri.001G398700 [exp]	4.58	0.8332
AT4G39900			unknown protein		Potri.007G093200 [exp]	5.19	0.8137
AT3G17130			Plant invertase/pectin methyle...		Potri.008G102600 [exp]	6.70	0.7731
AT5G41050			Pollen Ole e 1 allergen and ex...		Potri.001G326200 [exp]	9.59	0.8088
AT3G13175			unknown protein		Potri.001G366900 [exp]	12.00	0.7730
AT3G28040			Leucine-rich receptor-like pro...		Potri.002G233600 [exp]	12.24	0.7848
AT5G66460		MAN7, AtMAN7	endo-beta-mannase 7, Glycosyl ...		Potri.005G229600 [exp]	14.69	0.6695
AT5G13760			Plasma-membrane choline transp...		Potri.001G261900 [exp]	14.69	0.7851
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004366 [exp]	15.09	0.7079

Compare expression of checked genes

Potri.008G132600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.