Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14870 185 / 2e-60 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1) AT5G35525 181 / 1e-58 PLAC8 family protein (.1) AT1G14880 166 / 1e-52 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1) AT3G18460 148 / 2e-45 PLAC8 family protein (.1) AT1G68610 145 / 1e-44 PCR11 PLANT CADMIUM RESISTANCE 11 (.1) AT3G18470 138 / 3e-42 PLAC8 family protein (.1) AT3G18450 139 / 6e-42 PLAC8 family protein (.1) AT1G49030 134 / 2e-39 PLAC8 family protein (.1) AT1G58320 116 / 3e-33 PLAC8 family protein (.1) AT1G68630 115 / 1e-32 PLAC8 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G132850 [exp] 313 / 1e-110 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G109100 [exp] 224 / 5e-75 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G108900 [exp] 207 / 1e-68 AT1G14870 142 / 4e-43 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G108800 [exp] 190 / 6e-62 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G127700 [exp] 185 / 1e-59 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1) Potri.008G132900 [exp] 178 / 5e-57 AT1G14870 189 / 7e-62 PLANT CADMIUM RESISTANCE 2 (.1) Potri.007G042800 [exp] 170 / 4e-54 AT1G14870 152 / 7e-48 PLANT CADMIUM RESISTANCE 2 (.1) Potri.012G092200 [exp] 166 / 2e-52 AT1G14870 164 / 2e-52 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G127800 [exp] 130 / 2e-38 AT1G68630 151 / 1e-47 PLAC8 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021696 [exp] 181 / 7e-58 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1) Lus10043325 [exp] 175 / 6e-56 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1) Lus10019478 [exp] 173 / 4e-55 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1) Lus10034298 [exp] 172 / 5e-55 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1) Lus10004063 [exp] 116 / 2e-33 AT1G68630 132 / 2e-40 PLAC8 family protein (.1) Lus10009036 [exp] 114 / 2e-32 AT1G68630 122 / 2e-36 PLAC8 family protein (.1) Lus10041474 [exp] 114 / 2e-32 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1) Lus10008890 [exp] 106 / 2e-29 AT1G68630 119 / 6e-35 PLAC8 family protein (.1) Lus10004064 [exp] 103 / 1e-25 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1) Lus10005257 [exp] 90 / 2e-22 AT2G40935 228 / 6e-77 PLAC8 family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04749 [poplar] [flax] PLAC8 PLAC8 family
Representative CDS sequence Show only first row Show all	>Potri.008G132775.1 pacid=42807796 polypeptide=Potri.008G132775.1.p locus=Potri.008G132775 ID=Potri.008G132775.1.v4.1 annot-version=v4.1 ATGTATCCATCAAAGCAAGACACCGCTCATGAGATGAACCAAAAGCCATCACCTCCCTTGCCACCACCGGTGACCGGCTATCCAGTAGGACCCTTCATAA ATCAGCATCACAATGAGATTCATTCTCATCCCATTCAGCATCAACAGCCGCAGCCCGGTCGTTGGTCCTCCGGTCTTTGTGACTGCTTCTCTGACATCCC TAATTGTTGCATCACATGTTGGTGCCCGTGCATCACTTTTGGACGGATCGCTGAGATTGTAGACAAAGGAACAACACCCTGTGCTGTAAGCGGAGCAATT TATGGCGTACTTTTATGGTTCACTGGTTGTCCTTGCATATACTCGTGTATATATCGAACTAAAATGAGGAAGCAGCTGATGTTAGAGGACAGACCTTGTA ATGATTGCTTGGTTCACTTCTGCTGTGATGCTTGTGCTCTGTGTCAGGAGTACAGAGAGCTCAAACATCGTGGATTTGATATGACAATGGGTTGGCAAGA GAATGTGGAGAGACAAAATGGTAGAGTGACCATCATCGCATCAGCACCGCCCGTTGAACAAGGCATGAAACGCTGA
AA sequence Show only first row Show all	>Potri.008G132775.1 pacid=42807796 polypeptide=Potri.008G132775.1.p locus=Potri.008G132775 ID=Potri.008G132775.1.v4.1 annot-version=v4.1 MYPSKQDTAHEMNQKPSPPLPPPVTGYPVGPFINQHHNEIHSHPIQHQQPQPGRWSSGLCDCFSDIPNCCITCWCPCITFGRIAEIVDKGTTPCAVSGAI YGVLLWFTGCPCIYSCIYRTKMRKQLMLEDRPCNDCLVHFCCDACALCQEYRELKHRGFDMTMGWQENVERQNGRVTIIASAPPVEQGMKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.008G132775 [exp]	0	1
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.008G132850 [exp]	2.00	0.9642
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Potri.005G224100 [exp]	6.92	0.9268
AT3G52430		PAD4, ATPAD4	ARABIDOPSIS PHYTOALEXIN DEFICI...		Potri.005G068700 [exp]	12.96	0.9084
AT4G37640		ACA2	calcium ATPase 2 (.1)		Potri.007G055500 [exp]	14.89	0.9050	Pt-ACA2.1
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014328 [exp]	17.54	0.8806
					Potri.002G155402 [exp]	20.19	0.8531
					Potri.006G128250 [exp]	21.07	0.8831
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088290 [exp]	21.35	0.8997
AT4G39830			Cupredoxin superfamily protein...		Potri.007G088222 [exp]	22.44	0.9040
AT3G22910			ATPase E1-E2 type family prote...		Potri.008G159100 [exp]	30.57	0.8248	ACA13.1

Compare expression of checked genes

Potri.008G132775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.