Potri.008G132900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14870 189 / 7e-62 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1)
AT5G35525 172 / 2e-55 PLAC8 family protein (.1)
AT1G14880 162 / 2e-51 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1)
AT1G49030 146 / 5e-44 PLAC8 family protein (.1)
AT1G68610 141 / 4e-43 PCR11 PLANT CADMIUM RESISTANCE 11 (.1)
AT3G18470 135 / 5e-41 PLAC8 family protein (.1)
AT3G18460 134 / 6e-40 PLAC8 family protein (.1)
AT1G58320 126 / 2e-37 PLAC8 family protein (.1)
AT1G52200 122 / 5e-35 PLAC8 family protein (.1)
AT3G18450 120 / 2e-34 PLAC8 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G108800 342 / 8e-122 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G127700 187 / 2e-60 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1)
Potri.008G132775 179 / 1e-57 AT1G14870 185 / 2e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.008G132850 178 / 4e-57 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.007G042800 169 / 7e-54 AT1G14870 152 / 7e-48 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G108900 166 / 5e-52 AT1G14870 142 / 4e-43 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G109100 163 / 4e-51 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.012G092200 152 / 5e-47 AT1G14870 164 / 2e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.012G060900 153 / 5e-45 AT1G49030 199 / 2e-62 PLAC8 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043325 258 / 2e-88 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10019478 251 / 8e-86 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10021696 178 / 6e-57 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10034298 174 / 1e-55 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10041474 120 / 8e-35 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10004063 117 / 1e-33 AT1G68630 132 / 2e-40 PLAC8 family protein (.1)
Lus10009036 107 / 1e-29 AT1G68630 122 / 2e-36 PLAC8 family protein (.1)
Lus10008890 103 / 2e-28 AT1G68630 119 / 6e-35 PLAC8 family protein (.1)
Lus10004064 102 / 3e-25 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1)
Lus10005257 86 / 8e-21 AT2G40935 228 / 6e-77 PLAC8 family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04749 PLAC8 PLAC8 family
Representative CDS sequence
>Potri.008G132900.1 pacid=42806584 polypeptide=Potri.008G132900.1.p locus=Potri.008G132900 ID=Potri.008G132900.1.v4.1 annot-version=v4.1
ATGTACTCACAAAACCCATCTTCTTATGAAAAATTCTCCACTTCGCAGCCACCAGCGTTCAGTCAAGATACAACAACAACTGGGATCCCAGTCACCTCAA
CAAGCCAGTTCTACAGTACTGATGATTCTAGATCTTCTATTGAACTCCGATCCAAGAACAAAGGCCCTTGGTCAACTGGGTTGTGCGACTGCCATGATGA
TTGGCGAAACTGCTGCATAACGTTTTGGTGCCCCTGCGTCACATTTGGCCAAATTGCTGAAATCGTCGACAAGGGATCTTCGTCTTGTGGTGTAAATGGA
GCACTTTACGCACTGATTTCATGTGTTACTTGTTTTCCATGTTGCTACTCATGCTTCTACCGTGCAAAAATGAGGCAGCAGTACTTGTTGAGGGAAACCC
CTTGCGGGGACTGTCTGGTTCATTGCTTCTGCGAGTGTTGTTCTCTGTGTCAAGAGTATCGCGAGCTTAAAAGCCGTGGATATGATTTGGCTATGGGATG
GCATGGCAATGTGGAGAAAAAGAATCGCAGCTCAGAGATGGCTTCAGTGCCGCCAGTGGTTGAAGGGGGCATGAGCCGATAA
AA sequence
>Potri.008G132900.1 pacid=42806584 polypeptide=Potri.008G132900.1.p locus=Potri.008G132900 ID=Potri.008G132900.1.v4.1 annot-version=v4.1
MYSQNPSSYEKFSTSQPPAFSQDTTTTGIPVTSTSQFYSTDDSRSSIELRSKNKGPWSTGLCDCHDDWRNCCITFWCPCVTFGQIAEIVDKGSSSCGVNG
ALYALISCVTCFPCCYSCFYRAKMRQQYLLRETPCGDCLVHCFCECCSLCQEYRELKSRGYDLAMGWHGNVEKKNRSSEMASVPPVVEGGMSR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14870 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1... Potri.008G132900 0 1
AT1G60900 U2 snRNP auxilliary factor, la... Potri.004G040900 4.35 0.6488
AT4G37280 MRG family protein (.1) Potri.007G049300 6.00 0.6944
AT3G49430 SRP34A, SR34a, ... Serine/Arginine-Rich Protein S... Potri.012G021800 6.16 0.7198
AT1G56220 Dormancy/auxin associated fami... Potri.013G014900 8.00 0.7037
AT3G55380 UBC14 ubiquitin-conjugating enzyme 1... Potri.008G053900 8.12 0.7422 Pt-UBC7.1
AT2G44420 protein N-terminal asparagine ... Potri.009G023200 9.74 0.7025
AT2G32070 Polynucleotidyl transferase, r... Potri.018G020900 10.24 0.6607
AT2G25910 3'-5' exonuclease domain-conta... Potri.018G058900 14.49 0.6857
AT3G05675 BTB/POZ domain-containing prot... Potri.006G202900 15.29 0.6510
AT4G24740 AME1, AFC2 FUS3-complementing gene 2 (.1.... Potri.012G089700 15.29 0.6638

Potri.008G132900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.