Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01620 68 / 2e-14 MEE11 maternal effect embryo arrest 11, RNI-like superfamily protein (.1) AT3G26000 52 / 2e-08 Ribonuclease inhibitor (.1) AT3G27290 50 / 4e-08 RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G108600 [exp] 154 / 8e-47 AT2G01620 209 / 8e-66 maternal effect embryo arrest 11, RNI-like superfamily protein (.1) Potri.001G337300 [exp] 71 / 2e-15 AT3G26000 252 / 3e-79 Ribonuclease inhibitor (.1) Potri.010G054600 [exp] 68 / 2e-14 AT3G26000 395 / 7e-135 Ribonuclease inhibitor (.1) Potri.008G179800 [exp] 66 / 1e-13 AT3G26000 330 / 1e-109 Ribonuclease inhibitor (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007930 [exp] 72 / 1e-15 AT2G01620 195 / 9e-61 maternal effect embryo arrest 11, RNI-like superfamily protein (.1) Lus10006438 [exp] 64 / 1e-12 AT3G26000 240 / 1e-73 Ribonuclease inhibitor (.1) Lus10013466 [exp] 61 / 1e-11 AT2G01620 174 / 6e-53 maternal effect embryo arrest 11, RNI-like superfamily protein (.1) Lus10037060 [exp] 61 / 2e-11 AT3G26000 337 / 6e-112 Ribonuclease inhibitor (.1) Lus10011378 [exp] 56 / 1e-10 AT3G26000 78 / 3e-17 Ribonuclease inhibitor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G133100.2 pacid=42808433 polypeptide=Potri.008G133100.2.p locus=Potri.008G133100 ID=Potri.008G133100.2.v4.1 annot-version=v4.1 ATGCATGAAAGCACAGAATACTTTGTGCAGACTCAGCAAATTCTTTCTGCTTTTGTTTCTGGTCTTAGTTCCAAAAATAGATATAAAACCAAAAAGTGGA ACCAGGGGGGGCACCCCATGAGGTTCTATTTCTTGTCTTTGCGTACCTCGATGTACCTGAGCTTCACGAGTGAAGCTTGCATGCTGCTCAGAGATGCCGT GAACAAAGATGTATTATCATGGCGGGATATCATCATTGAAAAGCCTTTGAACTCGAGATTGTATGATGAGATTCTGGTGCAAATCACTTCGAAGGCGAAT GGAAAACTGAGAACTTTGCCTCTTTTAAACTGTTTCGAGATCACAGGATATGGGCTTCAAACCGTCATGGATAAAAATCCTTGA
AA sequence Show only first row Show all	>Potri.008G133100.2 pacid=42808433 polypeptide=Potri.008G133100.2.p locus=Potri.008G133100 ID=Potri.008G133100.2.v4.1 annot-version=v4.1 MHESTEYFVQTQQILSAFVSGLSSKNRYKTKKWNQGGHPMRFYFLSLRTSMYLSFTSEACMLLRDAVNKDVLSWRDIIIEKPLNSRLYDEILVQITSKAN GKLRTLPLLNCFEITGYGLQTVMDKNP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01620		MEE11	maternal effect embryo arrest ...		Potri.008G133100 [exp]	0	1
AT2G01630			O-Glycosyl hydrolases family 1...		Potri.008G133200 [exp]	1.00	0.8448
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Potri.005G246000 [exp]	2.00	0.8132
AT4G26080		AtABI1, ABI1	ABA INSENSITIVE 1, Protein pho...		Potri.006G164632 [exp]	3.00	0.8030
AT2G30090			Acyl-CoA N-acyltransferases (N...		Potri.009G074200 [exp]	7.93	0.7798
AT1G30220		ATINT2	ARABIDOPSIS THALIANA INOSITOL ...		Potri.004G133340 [exp]	10.48	0.7923
AT5G47610			RING/U-box superfamily protein...		Potri.001G453800 [exp]	13.26	0.7618
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Potri.004G028800 [exp]	15.09	0.7878
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Potri.017G094500 [exp]	22.58	0.7381
AT5G17680			disease resistance protein (TI...		Potri.019G069500 [exp]	24.24	0.7857
AT3G30380			alpha/beta-Hydrolases superfam...		Potri.017G102500 [exp]	24.97	0.7832

Compare expression of checked genes

Potri.008G133100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.