Plant FIBer expression Database

Potri.008G134100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67920 68 / 8e-17 unknown protein
AT1G24600 57 / 1e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G107200
[exp]
102 / 3e-30 AT1G67920 62 / 1e-14 unknown protein
Potri.012G044001
[exp]
50 / 1e-09 AT1G67920 44 / 2e-07 unknown protein
Potri.015G034800
[exp]
50 / 1e-09 AT1G67920 48 / 4e-09 unknown protein
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G134100.1 pacid=42808544 polypeptide=Potri.008G134100.1.p locus=Potri.008G134100 ID=Potri.008G134100.1.v4.1 annot-version=v4.1
ATGGAGAACAATAGCAGCAACGACGACAGCAGAGGCAGAAATGGAGATGGAGATCATGGATATGTGGGGTTTCCAATTCACAGTCAGGTTATAAAGATCA
GGCAAGAATTTGACAAGATCAAGCATCCATCTCTACAGCAGCTAGAGGTGAGAGGGGTTGTAAAATGCAGGATCAACAGGCAGCGATCGCGTTCACCACT
AGGTCTAGCTGAGAGACCCATCTCAGTAGGCAACTAA
AA sequence
>Potri.008G134100.1 pacid=42808544 polypeptide=Potri.008G134100.1.p locus=Potri.008G134100 ID=Potri.008G134100.1.v4.1 annot-version=v4.1
MENNSSNDDSRGRNGDGDHGYVGFPIHSQVIKIRQEFDKIKHPSLQQLEVRGVVKCRINRQRSRSPLGLAERPISVGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67920 unknown protein Potri.008G134100
[exp]
0 1
AT4G20880 ethylene-responsive nuclear pr... Potri.011G162400
[exp]
2.00 0.8242
AT5G38200 Class I glutamine amidotransfe... Potri.010G120600
[exp]
8.00 0.7810
AT3G14470 NB-ARC domain-containing disea... Potri.001G025400
[exp]
8.24 0.8091
AT3G09280 unknown protein Potri.006G092200
[exp]
17.23 0.6433
AT5G16940 carbon-sulfur lyases (.1.2) Potri.017G132500
[exp]
17.72 0.6173
AT3G17380 TRAF-like family protein (.1) Potri.014G055400
[exp]
17.74 0.7225
AT4G12010 Disease resistance protein (TI... Potri.019G097100
[exp]
18.89 0.7851
AT4G16860 RPP5, RPP4 recognition of peronospora par... Potri.019G098800
[exp]
18.97 0.7789
AT5G23360 GRAM domain-containing protein... Potri.017G152900
[exp]
21.02 0.6985
AT3G44110 ATJ3 DNAJ homologue 3 (.1.2) Potri.014G055300
[exp]
21.07 0.7634

Potri.008G134100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.