Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62500 77 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G10940 57 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G12100 53 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22142 49 / 8e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 47 / 9e-07 AZI1 azelaic acid induced 1 (.1) AT3G22120 48 / 2e-06 CWLP cell wall-plasma membrane linker protein (.1) AT4G12500 47 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 47 / 2e-06 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 46 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G22460 45 / 4e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G065500 [exp] 61 / 2e-11 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G126000 [exp] 60 / 1e-10 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008500 [exp] 52 / 3e-08 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 52 / 5e-08 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 52 / 7e-08 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 49 / 1e-07 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 47 / 8e-07 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 45 / 3e-06 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 44 / 7e-06 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032262 [exp] 77 / 6e-17 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028930 [exp] 75 / 3e-16 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004349 [exp] 62 / 2e-11 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10027704 [exp] 51 / 7e-08 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010482 [exp] 49 / 8e-08 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010479 [exp] 52 / 1e-07 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010480 [exp] 51 / 1e-07 ND 127 / 3e-34 Lus10003801 [exp] 50 / 4e-07 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10009282 [exp] 48 / 4e-07 AT4G00165 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10003802 [exp] 50 / 5e-07 ND 127 / 5e-33
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14547 [poplar] [flax] Hydrophob_seed Hydrophobic seed protein
Representative CDS sequence Show only first row Show all	>Potri.008G135860.1 pacid=42808220 polypeptide=Potri.008G135860.1.p locus=Potri.008G135860 ID=Potri.008G135860.1.v4.1 annot-version=v4.1 ATGGGTTCTAAATTTGCAGCCATGCTTTTCATCTTCATGATCTTCATGGCAATATCCTTGCCACCCATTTATGCTGGCACTCCTTGCACTCAACCCCATC CACCATCATACCCTCACCCTCCACCGCCCAACCCGCCCTATAGTTCCTCACCCAAAACCACCAACCACGAAGCATCCACCGCATCATGGAGGCCACTCAC CTTCCAAGAAACCACCATTGCCACCAGTAGTACTACCACCAATTATAATAAATCCCCCGCCAGTGATAACACCTCCAGTAATAGCACCACCTATAACAAA CCCTCCTGTGATAACACCACCACCTTCTTCAAGCTACCCTCCATATCCACCTGGTTCTGGTGGTCCTCCATTTGGCGGAGGTGGTGGTGGTGGAGGAGGA GGAGGAGGTGGTGGTGGGGGTGGCGGGGTGGCAGCATTCCAGGGGTTAATCCTCCTCCAACAACCCAACCAACTTGTCCAATCAATGCATTAAAACTAGG GGCTTGCGTTGATGTGCTAGGAGGCTTGGTGCATGTTGGATTAGGGAACCCAGTTGAGAATGTTTGCTGTCCTGTGCTTAAAGGATTGCTAGAGCTTGAA GCAGCTATTTGTCTTTGCACTAGTAAAGGCTTAAGCTCCTTAACCTCACCATTTTCATTCCTCTAG
AA sequence Show only first row Show all	>Potri.008G135860.1 pacid=42808220 polypeptide=Potri.008G135860.1.p locus=Potri.008G135860 ID=Potri.008G135860.1.v4.1 annot-version=v4.1 MGSKFAAMLFIFMIFMAISLPPIYAGTPCTQPHPPSYPHPPPPNPPYSSSPKTTNHEASTASWRPLTFQETTIATSSTTTNYNKSPASDNTSSNSTTYNK PSCDNTTTFFKLPSISTWFWWSSIWRRWWWWRRRRRWWWGWRGGSIPGVNPPPTTQPTCPINALKLGACVDVLGGLVHVGLGNPVENVCCPVLKGLLELE AAICLCTSKGLSSLTSPFSFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G62500			Bifunctional inhibitor/lipid-t...		Potri.008G135860 [exp]	0	1
AT1G62500			Bifunctional inhibitor/lipid-t...		Potri.003G111300 [exp]	1.00	0.9415
AT4G31830			unknown protein		Potri.018G018300 [exp]	4.24	0.6880
AT3G03480		CHAT	acetyl CoA:(Z)-3-hexen-1-ol ac...		Potri.001G447832 [exp]	8.71	0.7658
AT1G04150			C2 calcium/lipid-binding plant...		Potri.002G254400 [exp]	13.41	0.7130
AT5G56970		ATCKX3, CKX3	cytokinin oxidase 3 (.1)		Potri.006G152500 [exp]	16.30	0.6722	CKX3.1
AT5G57420	AUX_IAA	IAA33	indole-3-acetic acid inducible...		Potri.006G166900 [exp]	19.74	0.7345
AT2G25735			unknown protein		Potri.006G244200 [exp]	20.92	0.7000
AT5G61820			unknown protein		Potri.015G108700 [exp]	31.24	0.7206
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.006G010200 [exp]	32.03	0.6562
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Potri.010G055400 [exp]	36.74	0.6126	Pt-GAPDH.3

Compare expression of checked genes

Potri.008G135860 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.