Potri.008G138300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14730 252 / 3e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT4G25570 160 / 6e-49 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 159 / 1e-48 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 100 / 5e-26 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G102400 357 / 1e-126 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.004G103800 170 / 7e-53 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.017G111700 163 / 4e-50 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.015G143700 163 / 4e-50 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 157 / 4e-48 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115300 146 / 1e-43 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.008G115200 107 / 2e-28 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 105 / 2e-27 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034427 278 / 3e-95 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 261 / 1e-88 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10035096 174 / 9e-51 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1)
Lus10039216 158 / 3e-48 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 143 / 2e-42 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 140 / 1e-40 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 139 / 2e-40 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 122 / 6e-35 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10028996 115 / 2e-31 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034074 112 / 1e-29 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.008G138300.1 pacid=42806978 polypeptide=Potri.008G138300.1.p locus=Potri.008G138300 ID=Potri.008G138300.1.v4.1 annot-version=v4.1
ATGGATGCTGGCAGCACAATCTACAAGCAATCAGCCTCTCGTCTAACCGTGATAACACACTTGTTTGGCATCTTGGCTATAATTCTAATGCTGGTTTGGT
TATTGCATTATCGCGGTGGCATCGAGTATCATTCTGATAATCCTGATCGTGTTTTCAATGCTCATCCGTTTTTTATGTTCTGTGGACTCATATTTCTTGC
TGGGGAAGCGATGATGACATACAAAACAATATCATCGGCAATGATTGTCCAGAAGTCTATCCACATGTTCCTGCATCTGATTGCCCTGTGCCTTGGTATT
GTTGGCATATGTGCTGTTTTCAGGTTCCATGATATGATCCAAGCAGAGGATGTTTATAGCTTGCATTCATGGGTTGGGTTGAGCACCTTCTGTTTATTTT
GCTTGCAGTGGGTGTTCGGCTTCTTTACATTCATGTTTCCAAAAGCTGGGAAACAAACAAGGGCAAGCATGCTTCCATGGCACGTATGTGGGGGGAGAGC
ACTGTTATACATGGCAACATGTGCAGCACTGACTGGGTTAATTGAGAAAGCTACATTCCTCGAGCTAAAGCATCATCGCGAGTCTCATTTGATTAACTTC
ACTGGACTCTTCATCCTTCTCTTCGGCATATTCGTTGACCTCTCGGTTGCTCTTGCCCGTTATGTGTGA
AA sequence
>Potri.008G138300.1 pacid=42806978 polypeptide=Potri.008G138300.1.p locus=Potri.008G138300 ID=Potri.008G138300.1.v4.1 annot-version=v4.1
MDAGSTIYKQSASRLTVITHLFGILAIILMLVWLLHYRGGIEYHSDNPDRVFNAHPFFMFCGLIFLAGEAMMTYKTISSAMIVQKSIHMFLHLIALCLGI
VGICAVFRFHDMIQAEDVYSLHSWVGLSTFCLFCLQWVFGFFTFMFPKAGKQTRASMLPWHVCGGRALLYMATCAALTGLIEKATFLELKHHRESHLINF
TGLFILLFGIFVDLSVALARYV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14730 Cytochrome b561/ferric reducta... Potri.008G138300 0 1
AT5G63100 S-adenosyl-L-methionine-depend... Potri.015G082432 6.32 0.9090
AT4G24175 unknown protein Potri.005G240800 13.78 0.9030
AT2G39830 LRD3, DAR2 LATERAL ROOT DEVELOPMENT 3, DA... Potri.009G111446 16.30 0.8943
AT1G17870 ATEGY3 ethylene-dependent gravitropis... Potri.001G289700 18.43 0.8764
AT3G06730 TRXz, TRXP ,TRX... thioredoxin putative plastidic... Potri.001G028500 18.73 0.9014
AT2G44920 Tetratricopeptide repeat (TPR)... Potri.008G058800 19.49 0.8989
AT4G01650 Polyketide cyclase / dehydrase... Potri.014G110600 20.68 0.8995
AT2G23180 CYP96A1 "cytochrome P450, family 96, s... Potri.015G087000 23.36 0.8598
AT5G66520 Tetratricopeptide repeat (TPR)... Potri.004G237000 24.61 0.8986
AT3G04610 FLK flowering locus KH domain, RNA... Potri.013G043000 25.92 0.7757

Potri.008G138300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.