Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37870 121 / 1e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G05960 88 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G53980 88 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G13900 38 / 0.0007 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G100600 [exp] 169 / 2e-55 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G196300 [exp] 89 / 1e-23 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G104300 [exp] 84 / 6e-22 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G061800 [exp] 84 / 1e-21 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G131500 [exp] 43 / 1e-05 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G196000 [exp] 39 / 0.0003 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031925 [exp] 113 / 2e-32 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10009872 [exp] 81 / 3e-20 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004677 [exp] 80 / 5e-20 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000397 [exp] 72 / 5e-17 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.008G141000.1 pacid=42806289 polypeptide=Potri.008G141000.1.p locus=Potri.008G141000 ID=Potri.008G141000.1.v4.1 annot-version=v4.1 ATGTATGTAGCAATTAGAGTGAAGTTGCCTTCTTCGAGAATAGAAACAATGAGTAGCAACATGAGAGCCTGGGTTGTGGTTATGTTAGCTTGTTTGGTAG CTTCAAATGTTTTCATATGTGATGTTAATGCGGCAGGAGAGTGTGGGAAGACACCAATTAGGTCAGCAGCGGCTAGCTTGAGCCCATGCTTGAGCGCGGC AGGCAATGTAAGGGCCGCTGTGCCACCGACTTGCTGCTCCAAAGTTGGTTCCTTGATCAAGACTGCCCCGAAATGTCTCTGTGCTGTATTGCTGTCACCT CTGGCAAAGCAAGCTGGAATTAAGCCAGGAATTGCCATCACCATTCCAAAGCGTTGCAACATTGGAAACAGACCAGCTGGAAAGAAGTGTGGAAGGTACA CGCTCCCATGA
AA sequence Show only first row Show all	>Potri.008G141000.1 pacid=42806289 polypeptide=Potri.008G141000.1.p locus=Potri.008G141000 ID=Potri.008G141000.1.v4.1 annot-version=v4.1 MYVAIRVKLPSSRIETMSSNMRAWVVVMLACLVASNVFICDVNAAGECGKTPIRSAAASLSPCLSAAGNVRAAVPPTCCSKVGSLIKTAPKCLCAVLLSP LAKQAGIKPGIAITIPKRCNIGNRPAGKKCGRYTLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37870			Bifunctional inhibitor/lipid-t...		Potri.008G141000 [exp]	0	1
AT2G44300			Bifunctional inhibitor/lipid-t...		Potri.001G232000 [exp]	1.41	0.8722
AT5G05960			Bifunctional inhibitor/lipid-t...		Potri.008G061800 [exp]	2.44	0.8284
AT3G63250		HMT-2, ATHMT-2 ...	HOMOCYSTEINE METHYLTRANSFERASE...		Potri.002G049800 [exp]	5.19	0.6812	HMT1,SMTA.1
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Potri.014G074600 [exp]	6.48	0.6718
AT5G24090		ATCHIA	chitinase A (.1)		Potri.015G024200 [exp]	8.00	0.7644	CHIB1.1
AT3G51750			unknown protein		Potri.016G124000 [exp]	14.49	0.6902
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120401 [exp]	16.73	0.6306
					Potri.003G060432 [exp]	18.84	0.7363
AT2G17840		ERD7	EARLY-RESPONSIVE TO DEHYDRATIO...		Potri.004G174100 [exp]	19.74	0.6285	Pt-ERD7.1
AT5G20280		SPSA1, ATSPS1F	sucrose-phosphate synthase A1,...		Potri.018G025100 [exp]	20.37	0.6031	SPS.2

Compare expression of checked genes

Potri.008G141000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.