Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30050 466 / 1e-167 transducin family protein / WD-40 repeat family protein (.1) AT3G01340 457 / 2e-164 Transducin/WD40 repeat-like superfamily protein (.1.2) AT2G26060 58 / 2e-09 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) AT1G64350 52 / 9e-08 SEH1H Transducin/WD40 repeat-like superfamily protein (.1) AT3G44530 53 / 1e-07 HIRA homolog of histone chaperone HIRA (.1.2) AT2G43770 49 / 2e-06 Transducin/WD40 repeat-like superfamily protein (.1) AT5G64630 49 / 3e-06 MUB3.9, NFB1, NFB01, MUB3, FAS2 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3) AT4G02730 47 / 1e-05 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) AT1G11160 46 / 2e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT3G18860 46 / 2e-05 transducin family protein / WD-40 repeat family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G068900 [exp] 542 / 0 AT2G30050 526 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Potri.010G100400 [exp] 533 / 0 AT2G30050 517 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Potri.009G144800 [exp] 62 / 1e-10 AT3G44530 1398 / 0.0 homolog of histone chaperone HIRA (.1.2) Potri.004G184900 [exp] 61 / 2e-10 AT3G44530 1365 / 0.0 homolog of histone chaperone HIRA (.1.2) Potri.001G221000 [exp] 54 / 4e-08 AT2G26060 523 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.002G212800 [exp] 52 / 2e-07 AT2G26060 530 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.003G138300 [exp] 49 / 2e-06 AT1G64350 457 / 4e-163 Transducin/WD40 repeat-like superfamily protein (.1) Potri.011G045500 [exp] 49 / 3e-06 AT1G61210 723 / 0.0 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.019G096900 [exp] 48 / 3e-06 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011429 [exp] 502 / 0 AT2G30050 525 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10037571 [exp] 501 / 0 AT2G30050 523 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10003896 [exp] 56 / 1e-08 AT1G64350 434 / 4e-154 Transducin/WD40 repeat-like superfamily protein (.1) Lus10004893 [exp] 56 / 2e-08 AT3G44530 1389 / 0.0 homolog of histone chaperone HIRA (.1.2) Lus10017045 [exp] 55 / 2e-08 AT2G26060 486 / 5e-174 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021365 [exp] 55 / 2e-08 AT2G26060 482 / 2e-172 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10020585 [exp] 55 / 4e-08 AT3G44530 1395 / 0.0 homolog of histone chaperone HIRA (.1.2) Lus10001904 [exp] 54 / 4e-08 AT1G64350 442 / 3e-157 Transducin/WD40 repeat-like superfamily protein (.1) Lus10042333 [exp] 49 / 1e-06 AT3G18140 572 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10011224 [exp] 49 / 3e-06 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.008G141300.2 pacid=42808297 polypeptide=Potri.008G141300.2.p locus=Potri.008G141300 ID=Potri.008G141300.2.v4.1 annot-version=v4.1 ATGCCTTCTCAAAAAATTGAAACTGGTCATGAGGACACTGTCCATGATGTGGCAATGGATTACTATGGAAAGCGGATTGCAACTGCCTCATCGGATCATT CAATCAAAATAATTGGGGTTAACAACAATACTTCTCAACATCTTGCAAATCTGACCGGGCACCAAGGCCCAGTTTGGCAAGAGGGTAATCAGAATGACTG GACACAGGCTCATGTTTTTGACGATCACAAATCATCTGTCAATTCCATTGCTTGGGCACCTCATGAACTGGGGCTTTCTTTGGCATGTGGTTCATCTGAT GGGAATATATCTGTTTTTACTGCACGTGCTGATGGCAACTGGGACACATCAAGGATTGATCAAGCTCACCCGGTTGGTGTAACCTCTGTTTCATGGGCTC CATCCACTGCACCTGGTGCCCTTGTTGGTTCTGGTTTGCTTGACCCTGTTCAGAAGCTTTGTTCAGGTGGCTGTGATAATACTGTCAAAGTGTGGAAACT TTACAACGGGAACTGGAAGCTGGACTGTTTTCCAGCTCTCAACATGCATACTGATTGGGTGAGGGATGTTGCTTGGGCACCCAACTTGGGCTTTCCCAAA TCTACCATTGCTAGTGCCTCACAGGATGGGAAGGTTATTATATGGACTGTGGCAAAGGAAGGTGATCAATGGGAAGGTAAGGTTTTACATGACTTCAAGG CTCCTGTCTGGAGGGTCTCCTGGTCCCTAACTGGAAACATACTGGCTGTTGCTGATGGGAACAACAATGTCACGTTGTGGAAAGAAGCCGTAGATGGGGA ATGGCAACAGGTGACAACTGTTGATGCCTAG
AA sequence Show only first row Show all	>Potri.008G141300.2 pacid=42808297 polypeptide=Potri.008G141300.2.p locus=Potri.008G141300 ID=Potri.008G141300.2.v4.1 annot-version=v4.1 MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIIGVNNNTSQHLANLTGHQGPVWQEGNQNDWTQAHVFDDHKSSVNSIAWAPHELGLSLACGSSD GNISVFTARADGNWDTSRIDQAHPVGVTSVSWAPSTAPGALVGSGLLDPVQKLCSGGCDNTVKVWKLYNGNWKLDCFPALNMHTDWVRDVAWAPNLGFPK STIASASQDGKVIIWTVAKEGDQWEGKVLHDFKAPVWRVSWSLTGNILAVADGNNNVTLWKEAVDGEWQQVTTVDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30050			transducin family protein / WD...		Potri.008G141300 [exp]	0	1
AT5G36290			Uncharacterized protein family...		Potri.013G086700 [exp]	1.00	0.9664
AT1G14020			O-fucosyltransferase family pr...		Potri.008G090600 [exp]	3.16	0.9523
AT4G33945			ARM repeat superfamily protein...		Potri.004G144100 [exp]	3.87	0.9592
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.009G031200 [exp]	4.00	0.9536
AT1G12000			Phosphofructokinase family pro...		Potri.011G015600 [exp]	4.24	0.9634
					Potri.017G113750 [exp]	5.74	0.9355
AT1G47830			SNARE-like superfamily protein...		Potri.002G022900 [exp]	6.24	0.9458
AT3G07810			RNA-binding (RRM/RBD/RNP motif...		Potri.011G088100 [exp]	7.48	0.9503
AT5G19320		RANGAP2	RAN GTPase activating protein ...		Potri.010G091100 [exp]	7.48	0.9369	Pt-RANGAP2.1
AT1G51160			SNARE-like superfamily protein...		Potri.017G149900 [exp]	7.48	0.9456

Compare expression of checked genes

Potri.008G141300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.