Pt-TRIP.2 (Potri.008G141400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TRIP.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G46290 553 / 0 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G46280 542 / 0 TIF3I1, TRIP-1 TGF-beta receptor interacting protein 1 (.1.2.3)
AT1G15470 147 / 1e-41 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G15610 135 / 5e-37 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G52730 134 / 1e-36 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT1G11160 78 / 1e-15 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G67320 77 / 2e-15 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
AT5G64730 73 / 1e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G49660 73 / 2e-14 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
AT4G02730 69 / 5e-13 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G100101 649 / 0 AT2G46290 553 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G174600 149 / 6e-42 AT1G52730 577 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.003G059500 147 / 2e-41 AT1G52730 573 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.001G306500 83 / 5e-18 AT5G64730 489 / 2e-176 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.018G020200 79 / 6e-16 AT5G25150 984 / 0.0 TBP-associated factor 5 (.1)
Potri.005G148500 76 / 3e-15 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.019G096900 76 / 3e-15 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.007G009500 73 / 1e-14 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.006G045800 74 / 2e-14 AT2G41500 614 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010332 608 / 0 AT2G46290 550 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10021857 608 / 0 AT2G46290 549 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10019450 132 / 1e-35 AT3G15610 577 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10043302 115 / 1e-29 AT3G15610 502 / 2e-180 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10021059 82 / 6e-17 AT2G41500 706 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10004167 80 / 3e-16 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10039636 77 / 8e-16 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10002090 76 / 2e-15 AT5G64730 525 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003855 74 / 6e-15 AT5G64730 524 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10024447 75 / 1e-14 AT5G25150 1006 / 0.0 TBP-associated factor 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Potri.008G141400.1 pacid=42808490 polypeptide=Potri.008G141400.1.p locus=Potri.008G141400 ID=Potri.008G141400.1.v4.1 annot-version=v4.1
ATGAGACCAATTTTGATGAAAGGGCATGAAAGGCCCTTAACATTCTTAAAGTACAACAGAGAAGGGGATCTCTTGTTTTCCTGCGCTAAAGATCATAATC
CCACCGTCTGGTTCGCCGATAACGGCGAACGTTTGGGAACTTACCGTGGTCACAACGGCGCCGTTTGGTGTTGCGATGTCTCAAGAGATTCGATGCAGCT
GATTACTGCTAGTGCGGATCAGTCGGTGAAGCTTTGGAATGTACAAACTGGAGCGCAATTGTACACATTTAGTTTCAATTCGCCGGCTCGGTCTGTGGAC
TTTTCTGTAGGTGACAAGCTTGCTGTTATTACCACTGATCCTTTCATGGGAGTCACTTCTGCCATTAATGTCAAACGCATTTCTGACGATCCTTCCCAGC
AGAGTGGTGAATCCGTGCTCACCATCACTGGACCTGCGGGAAGAATTAATAGAGCTGTTTGGGGACCCCTGAACAGGACTATCATAAGTGCTGGAGAGGA
TTGTGTGGTCCGCATTTGGGATTCTGAGACTGGAAAATTGTTGAAAGAGTCGGAACCGGAAGTTGGGCATAAGAAGCCGATATCATCACTCACAAAATCT
GCTGATGGTTCTCACTTCCTGACTGGTTCTCTAGATAAATCTGCGAAGCTTTGGGACTCCAGAACTTTAACTCTTATCAAGAACTACACAACAGAACGCC
CAGTTAATGCTGTTACAATGTCTCCGCTACTTGATCATGTTGTGCTTGGAGGTGGTCAGGATGCATCATCTGTAACCACAACTGATCACCGTGCTGGGAA
GTTTGAAGCCAAATTCTACGACAAGATTCTTCAAGAAGAAATTGGTGGTGTGAAAGGTCATTTCGGACCTATAAATGCTTTGGCGTTTAACCCTGATGGG
AAAAGTTTCTCAAGTGGAGGCGAGGACGGTTATGTGAGGCTGCATCACTTCGATCCTGATTATTTCAACATAAAGATTTAG
AA sequence
>Potri.008G141400.1 pacid=42808490 polypeptide=Potri.008G141400.1.p locus=Potri.008G141400 ID=Potri.008G141400.1.v4.1 annot-version=v4.1
MRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWCCDVSRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVD
FSVGDKLAVITTDPFMGVTSAINVKRISDDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKLLKESEPEVGHKKPISSLTKS
ADGSHFLTGSLDKSAKLWDSRTLTLIKNYTTERPVNAVTMSPLLDHVVLGGGQDASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG
KSFSSGGEDGYVRLHHFDPDYFNIKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G46290 Transducin/WD40 repeat-like su... Potri.008G141400 0 1 Pt-TRIP.2
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Potri.019G131900 1.41 0.9649 Pt-RPL10.4
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G072700 2.44 0.9655
AT1G49410 TOM6 translocase of the outer mitoc... Potri.004G149200 3.74 0.9473 TOM6.1
AT4G36130 Ribosomal protein L2 family (.... Potri.005G115700 6.63 0.9588 RPL2.2
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Potri.017G101000 7.07 0.9579 Pt-RPL7.7
AT3G56340 Ribosomal protein S26e family ... Potri.013G093700 7.54 0.9423 RPS26.1
AT5G35530 Ribosomal protein S3 family pr... Potri.006G222100 7.74 0.9595
AT1G57720 Translation elongation factor ... Potri.019G077000 7.93 0.9419
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Potri.016G063200 8.94 0.9522 Pt-RPS5.1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 9.38 0.9558

Potri.008G141400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.