Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56030 140 / 1e-40 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G40240 130 / 3e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G13150 55 / 3e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G53700 49 / 3e-07 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G25630 47 / 2e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G04810 46 / 5e-06 pentatricopeptide (PPR) repeat-containing protein (.1) AT5G40400 45 / 1e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G11690 44 / 1e-05 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G61520 44 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G28460 44 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G037200 [exp] 53 / 1e-08 AT5G25630 694 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G032600 [exp] 49 / 3e-07 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.012G031600 [exp] 49 / 4e-07 AT5G16420 707 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.008G017400 [exp] 48 / 7e-07 AT5G04810 1278 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.004G013300 [exp] 48 / 9e-07 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G241300 [exp] 48 / 9e-07 AT5G04810 1230 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.008G108300 [exp] 48 / 1e-06 AT3G16890 771 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1) Potri.001G139300 [exp] 46 / 4e-06 AT5G01110 275 / 1e-81 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G081700 [exp] 45 / 8e-06 AT5G21222 643 / 0.0 protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043104 [exp] 50 / 1e-07 AT3G16890 720 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1) Lus10003424 [exp] 49 / 4e-07 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1) Lus10032648 [exp] 49 / 4e-07 AT3G16890 225 / 1e-69 pentatricopeptide (PPR) domain protein 40 (.1) Lus10013077 [exp] 48 / 7e-07 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 48 / 9e-07 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008969 [exp] 48 / 1e-06 AT5G04810 1121 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10006373 [exp] 47 / 2e-06 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028850 [exp] 46 / 4e-06 AT5G04810 689 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10000364 [exp] 46 / 6e-06 AT1G22960 619 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021991 [exp] 45 / 8e-06 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.008G141700.5 pacid=42808806 polypeptide=Potri.008G141700.5.p locus=Potri.008G141700 ID=Potri.008G141700.5.v4.1 annot-version=v4.1 ATGGCGCGTGGCGCGTTTGGATTAAATGCCGGTGCCTTTCACCCCATAATCAGCTGTCTAACGAGAAAGAAGAATATGGAACGCTCGTGGAGCCTGATAG AGATAATGGCAGAGCTTGGGATTTCGCCGGATAGAACGACGCTTAATTATTTGTCAACGGCGTATCGTTTCAAAGGGGATTTAACGGCTGCAAGCGGAGT TGTGAAGAGGATTGAAGAGGAGGGGCTGGGTGTGGGCTCGCGTGCTTATGACGTGCCTGTGTTGGACGCGTGTAAGAAGGGTAAAGTGGAAGGGGCGTTG GTGGTGATGGAGTGCCGGTGTTGTATTCGACACGTGATCAACGCGCTGTTGAAGCAAGGGTACCATGATCAGGCAGTTAAATTTGTTATGGTTTGTGGAG GGAAAGAGGAGGGTTTGGATAGCGAGAATTTTAGGATTTTGGGGAGTAAGTTGATTGAGTTTGAGAGGTTTAAAGAAGCTAAGTTGGTTTTGGAGGAAAT GTAA
AA sequence Show only first row Show all	>Potri.008G141700.5 pacid=42808806 polypeptide=Potri.008G141700.5.p locus=Potri.008G141700 ID=Potri.008G141700.5.v4.1 annot-version=v4.1 MARGAFGLNAGAFHPIISCLTRKKNMERSWSLIEIMAELGISPDRTTLNYLSTAYRFKGDLTAASGVVKRIEEEGLGVGSRAYDVPVLDACKKGKVEGAL VVMECRCCIRHVINALLKQGYHDQAVKFVMVCGGKEEGLDSENFRILGSKLIEFERFKEAKLVLEEM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56030			Tetratricopeptide repeat (TPR)...		Potri.008G141700 [exp]	0	1
AT1G24290			AAA-type ATPase family protein...		Potri.011G023800 [exp]	2.00	0.8554
AT1G03220			Eukaryotic aspartyl protease f...		Potri.006G068900 [exp]	13.07	0.8453
AT3G25910			Protein of unknown function (D...		Potri.003G060800 [exp]	18.54	0.8435
					Potri.018G047150 [exp]	23.40	0.6779
					Potri.013G116750 [exp]	27.82	0.8323
AT1G09820			Pentatricopeptide repeat (PPR-...		Potri.005G014500 [exp]	30.85	0.8192
AT3G04880		DRT102	DNA-DAMAGE-REPAIR/TOLERATION 2...		Potri.005G050600 [exp]	31.98	0.7928	Pt-DRT102.2
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044000 [exp]	32.98	0.8341
					Potri.010G065733 [exp]	33.25	0.8227
					Potri.016G098150 [exp]	36.87	0.7571

Compare expression of checked genes

Potri.008G141700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.