Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02090 181 / 1e-54 CHA19, ETL1, CHR19 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1) AT3G12810 92 / 2e-22 CHR13, SRCAP, PIE1 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) AT3G06010 90 / 5e-22 ATCHR12 Homeotic gene regulator (.1) AT5G19310 90 / 6e-22 Homeotic gene regulator (.1) AT5G44800 88 / 2e-21 PKR1, CHR4, MI-2-LIKE PICKLE RELATED 1, chromatin remodeling 4 (.1) AT5G66750 87 / 6e-21 CHR01, CHA1, SOM1, CHR1, SOM4, DDM1, ATDDM1 SOMNIFEROUS 1, DECREASED DNA METHYLATION 1, chromatin remodeling 1 (.1) AT2G13370 87 / 9e-21 CHR5 chromatin remodeling 5 (.1) AT2G25170 86 / 9e-21 CKH2, SSL2, GYM, CHD3, PKL, CHR6 SUPPRESSOR OF SLR 2, GYMNOS, CYTOKININ-HYPERSENSITIVE 2, chromatin remodeling factor CHD3 (PICKLE) (.1) AT3G06400 86 / 2e-20 CHR11 chromatin-remodeling protein 11 (.1.2.3) AT5G18620 83 / 1e-19 CHR17 chromatin remodeling factor17 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G099000 [exp] 189 / 3e-57 AT2G02090 1061 / 0.0 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1) Potri.003G022100 [exp] 92 / 6e-23 AT3G12810 1824 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Potri.010G021400 [exp] 92 / 7e-23 AT3G06400 1748 / 0.0 chromatin-remodeling protein 11 (.1.2.3) Potri.008G205600 [exp] 92 / 8e-23 AT3G06400 1724 / 0.0 chromatin-remodeling protein 11 (.1.2.3) Potri.001G207700 [exp] 91 / 2e-22 AT3G12810 2199 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Potri.007G026700 [exp] 90 / 6e-22 AT5G66750 993 / 0.0 SOMNIFEROUS 1, DECREASED DNA METHYLATION 1, chromatin remodeling 1 (.1) Potri.019G129900 [exp] 89 / 1e-21 AT5G66750 1047 / 0.0 SOMNIFEROUS 1, DECREASED DNA METHYLATION 1, chromatin remodeling 1 (.1) Potri.018G021100 [exp] 89 / 1e-21 AT2G25170 1818 / 0.0 SUPPRESSOR OF SLR 2, GYMNOS, CYTOKININ-HYPERSENSITIVE 2, chromatin remodeling factor CHD3 (PICKLE) (.1) Potri.010G091200 [exp] 88 / 3e-21 AT3G06010 1408 / 0.0 Homeotic gene regulator (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039140 [exp] 187 / 2e-56 AT2G02090 1107 / 0.0 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1) Lus10013792 [exp] 186 / 2e-56 AT2G02090 1034 / 0.0 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1) Lus10024019 [exp] 92 / 2e-22 AT5G66750 1034 / 0.0 SOMNIFEROUS 1, DECREASED DNA METHYLATION 1, chromatin remodeling 1 (.1) Lus10007173 [exp] 91 / 2e-22 AT3G12810 668 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Lus10002974 [exp] 90 / 9e-22 AT3G12810 1071 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Lus10041735 [exp] 89 / 1e-21 AT5G66750 1069 / 0.0 SOMNIFEROUS 1, DECREASED DNA METHYLATION 1, chromatin remodeling 1 (.1) Lus10033967 [exp] 89 / 2e-21 AT5G18620 1650 / 0.0 chromatin remodeling factor17 (.1.2) Lus10012813 [exp] 89 / 2e-21 AT5G18620 952 / 0.0 chromatin remodeling factor17 (.1.2) Lus10034064 [exp] 89 / 2e-21 AT3G06010 1422 / 0.0 Homeotic gene regulator (.1) Lus10005339 [exp] 89 / 2e-21 AT2G25170 1787 / 0.0 SUPPRESSOR OF SLR 2, GYMNOS, CYTOKININ-HYPERSENSITIVE 2, chromatin remodeling factor CHD3 (PICKLE) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00271 [poplar] [flax] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.008G142600.2 pacid=42806955 polypeptide=Potri.008G142600.2.p locus=Potri.008G142600 ID=Potri.008G142600.2.v4.1 annot-version=v4.1 ATGGATAAACAGAACATGGTTGACGCTTTCAATAATGACACTTCGAAAGCATGCCTGCTGTCCACTAGAGCTGGAGGTCAGGGTTTGAACTTGACGGGAG CTGATACTGTATTTATCCCCGATTTGGATTTCAACCCACAAATTGATCGACAGGTAGAAGATCATTGTCATCGCATTGGCCATACTAAACCTGTCACCAT ATACAGAATGGTGACCAGGGGCACGGTTGATGAGACTGTTGACGAGATGGCAAAATGGAAGCTAGTTTTGGACGCTGCAGTGCTCGACTCTGGTGTGGGG GTAGATAACGAGGGAGATGCATCTTCGCGAACAACGGGGGAGATCTTATCATCACTTATGATGGTATAG
AA sequence Show only first row Show all	>Potri.008G142600.2 pacid=42806955 polypeptide=Potri.008G142600.2.p locus=Potri.008G142600 ID=Potri.008G142600.2.v4.1 annot-version=v4.1 MDKQNMVDAFNNDTSKACLLSTRAGGQGLNLTGADTVFIPDLDFNPQIDRQVEDHCHRIGHTKPVTIYRMVTRGTVDETVDEMAKWKLVLDAAVLDSGVG VDNEGDASSRTTGEILSSLMMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02090		CHA19, ETL1, CH...	CHROMATIN REMODELING 19, SNF2 ...		Potri.008G142600 [exp]	0	1
AT5G45610		SUV2	SENSITIVE TO UV 2, protein dim...		Potri.001G134800 [exp]	8.48	0.7768
AT5G63320		NPX1	nuclear protein X1 (.1.2.3)		Potri.012G094300 [exp]	12.88	0.8075
AT5G61990			Pentatricopeptide repeat (PPR)...		Potri.015G105400 [exp]	16.49	0.8037
AT2G25580			Tetratricopeptide repeat (TPR)...		Potri.014G116600 [exp]	16.52	0.7900
AT1G21610			wound-responsive family protei...		Potri.005G182300 [exp]	41.74	0.7791
AT3G08020			PHD finger family protein (.1)		Potri.009G059700 [exp]	48.29	0.7747
					Potri.002G055950 [exp]	53.28	0.7075
AT1G13120		EMB1745	embryo defective 1745 (.1)		Potri.008G183500 [exp]	53.38	0.7689
AT5G63540		BLAP75, ATRMI1	RECQ MEDIATED INSTABILITY 1, D...		Potri.015G100200 [exp]	55.13	0.7514
AT1G22860			Vacuolar sorting protein 39 (....		Potri.001G081900 [exp]	63.78	0.7692

Compare expression of checked genes

Potri.008G142600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.