Potri.008G146450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G146450.1 pacid=42806865 polypeptide=Potri.008G146450.1.p locus=Potri.008G146450 ID=Potri.008G146450.1.v4.1 annot-version=v4.1
ATGATTCGTGGGTTTTATCTTCGATCGCGTCAGATCCCTGTGTCGACGTTTGGCTTTTGCGAGAGAAGACACAGCACTGACACTGTAGTTGGTGACTGCC
AGTGGGTTTTGCTTCCACACAATCAAATCCGGCAGCCTCCTTCTCGCTCCCCTCTCTTTTCTAAATGCTGGTTATGCGATAATTAA
AA sequence
>Potri.008G146450.1 pacid=42806865 polypeptide=Potri.008G146450.1.p locus=Potri.008G146450 ID=Potri.008G146450.1.v4.1 annot-version=v4.1
MIRGFYLRSRQIPVSTFGFCERRHSTDTVVGDCQWVLLPHNQIRQPPSRSPLFSKCWLCDN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G146450 0 1
AT4G13230 Late embryogenesis abundant pr... Potri.002G252100 1.73 0.9542
AT5G16330 NC domain-containing protein-r... Potri.005G056300 2.44 0.9426
AT4G33820 Glycosyl hydrolase superfamily... Potri.009G087600 4.00 0.9123
Potri.006G190850 4.47 0.9100
AT3G13220 MSR02, AtABCG26... ATP-binding cassette G26, ABC-... Potri.001G370600 5.47 0.8355
Potri.010G080267 6.00 0.7744
AT1G53210 sodium/calcium exchanger famil... Potri.004G052800 10.48 0.7699
AT5G38760 Late embryogenesis abundant pr... Potri.004G107800 38.18 0.6634 Pt-LEA1.4
AT1G04410 c-NAD-MDH1 cytosolic-NAD-dependent malate... Potri.002G141900 44.11 0.8238
AT3G20190 Leucine-rich repeat protein ki... Potri.004G170274 55.27 0.6719

Potri.008G146450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.