Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G09990 262 / 7e-92 Ribosomal protein S5 domain 2-like superfamily protein (.1) AT5G18380 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3) AT3G04230 247 / 1e-85 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G091000 [exp] 290 / 7e-103 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1) Potri.001G304700 [exp] 286 / 2e-101 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038012 [exp] 273 / 4e-96 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10009252 [exp] 273 / 4e-96 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10035133 [exp] 272 / 2e-95 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10031970 [exp] 272 / 2e-95 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10012599 [exp] 271 / 3e-95 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3) Lus10034378 [exp] 271 / 4e-95 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0329 [poplar] [flax] S5 PF00380 [poplar] [flax] Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence Show only first row Show all	>Potri.008G150000.1 pacid=42806592 polypeptide=Potri.008G150000.1.p locus=Potri.008G150000 ID=Potri.008G150000.1.v4.1 annot-version=v4.1 ATGGCGGCGCCGACGGAGTCCGTGCAGTGCTTCGGAAGGAAGAAAACAGCAGTCGCAGTCACCCATTGCAAGCGCGGTCGCGGCCTGATCAAGATCAACG GCTGCCCAATCGAGCTTGTTGAGCCTGAAATCCTCCGATTCAAGGCCTATGAACCAATCCTTCTCTTAGGACGACAACGTTTTGCTGGAGTGGACATGAG GATCCGTGTCAAGGGTGGAGGACACACGTCTCAGATCTATGCGATCAGGCAGAGCATCGCAAAGGCACTTGTGGCGTTTTACCAGAAGTACGTGGATGAG CAGAGCAAGAAGGAGATAAAGGACATTTTGGTGAGGTATGATAGAACTTTGCTGGTTGCTGATCCTAGAAGGTGCGAGACTAAGAAGTTTGGTGGACGTG GCGCCAGAGCTAGATTCCAGAAATCTTACCGTTGA
AA sequence Show only first row Show all	>Potri.008G150000.1 pacid=42806592 polypeptide=Potri.008G150000.1.p locus=Potri.008G150000 ID=Potri.008G150000.1.v4.1 annot-version=v4.1 MAAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDE QSKKEIKDILVRYDRTLLVADPRRCETKKFGGRGARARFQKSYR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.008G150000 [exp]	0	1
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.008G187000 [exp]	1.00	0.9796
AT5G09500			Ribosomal protein S19 family p...		Potri.005G219700 [exp]	2.00	0.9737
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.001G304700 [exp]	2.44	0.9758	RPS16.3
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G211200 [exp]	2.82	0.9789
AT1G18080		RACK1A_AT, ATAR...	RECEPTOR FOR ACTIVATED C KINAS...		Potri.012G052700 [exp]	4.89	0.9653	Pt-GBF1.3
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	6.92	0.9683	RPL35.1
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	7.34	0.9711	RPL15.3
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.015G111500 [exp]	8.00	0.9628	Pt-UBI.4
AT1G67430			Ribosomal protein L22p/L17e fa...		Potri.015G094400 [exp]	8.06	0.9737	RPL17.2
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Potri.016G063200 [exp]	8.48	0.9587	Pt-RPS5.1

Compare expression of checked genes

Potri.008G150000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.