Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26250 153 / 1e-44 Major facilitator superfamily protein (.1) AT3G05960 150 / 7e-44 ATSTP6 sugar transporter 6 (.1) AT5G26340 140 / 8e-40 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) AT3G19940 127 / 7e-35 Major facilitator superfamily protein (.1) AT1G11260 125 / 4e-34 ATSTP1, STP1 sugar transporter 1 (.1) AT1G50310 122 / 4e-33 ATSTP9 sugar transporter 9 (.1) AT1G07340 122 / 5e-33 ATSTP2 sugar transporter 2 (.1) AT5G23270 121 / 6e-33 ATSTP11, STP11 sugar transporter 11 (.1) AT4G21480 118 / 9e-32 STP12 sugar transporter protein 12 (.1) AT1G77210 115 / 9e-31 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G090000 [exp] 218 / 2e-69 AT5G26250 664 / 0.0 Major facilitator superfamily protein (.1) Potri.001G248900 [exp] 140 / 9e-40 AT5G26250 652 / 0.0 Major facilitator superfamily protein (.1) Potri.008G150800 [exp] 139 / 1e-39 AT5G26250 725 / 0.0 Major facilitator superfamily protein (.1) Potri.008G150700 [exp] 139 / 1e-39 AT5G26250 725 / 0.0 Major facilitator superfamily protein (.1) Potri.008G151100 [exp] 133 / 4e-37 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Potri.009G042900 [exp] 129 / 2e-35 AT5G26250 577 / 0.0 Major facilitator superfamily protein (.1) Potri.005G090700 [exp] 126 / 2e-34 AT3G19940 710 / 0.0 Major facilitator superfamily protein (.1) Potri.004G033600 [exp] 125 / 2e-34 AT1G11260 822 / 0.0 sugar transporter 1 (.1) Potri.007G073850 [exp] 125 / 2e-34 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021926 [exp] 161 / 6e-48 AT5G26250 656 / 0.0 Major facilitator superfamily protein (.1) Lus10002452 [exp] 153 / 8e-45 AT5G26250 655 / 0.0 Major facilitator superfamily protein (.1) Lus10010532 [exp] 152 / 2e-44 AT5G26250 588 / 0.0 Major facilitator superfamily protein (.1) Lus10002450 [exp] 146 / 5e-42 AT5G26340 905 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10010534 [exp] 145 / 1e-41 AT5G26340 902 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10021924 [exp] 133 / 5e-37 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10040993 [exp] 123 / 4e-34 AT1G50310 601 / 0.0 sugar transporter 9 (.1) Lus10040991 [exp] 125 / 5e-34 AT3G19940 666 / 0.0 Major facilitator superfamily protein (.1) Lus10013441 [exp] 124 / 1e-33 AT1G50310 731 / 0.0 sugar transporter 9 (.1) Lus10018422 [exp] 124 / 1e-33 AT1G11260 835 / 0.0 sugar transporter 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [poplar] [flax] MFS PF00083 [poplar] [flax] Sugar_tr Sugar (and other) transporter
Representative CDS sequence Show only first row Show all	>Potri.008G150901.1 pacid=42808542 polypeptide=Potri.008G150901.1.p locus=Potri.008G150901 ID=Potri.008G150901.1.v4.1 annot-version=v4.1 ATGCATCCAAATGGATGGAGAGTATTCCTGGGGCTTGCTGGTGTGCCAGCTTTTGTCCTGTTTATAGGATCCATAGTCATCACTGGAACACCAACAAGCC TAATTGAATGCGGAAATGAAACTGCCGGGAAAAGCACGCTCAGGAAGATTAGAGGAGTCGACCATGTTAATGCTGAGTTCGAGCAATTTAAAGCTGCCAG TGAGATAGCCAGGCAAGTCAGGCATCCATACAAGAAAACCATGAAGTGCTCTAGCATGCCCACGCTAGTTATAGGCATCCAGTTGCAAATCTTTCATCAG CTTACAGGAATCGATGCTGTAATGTTTTACGCACTTGGATTCAAAAACGATGCTTCACTTTTGTCAGCTGTGATCACTGGAATTGTAAACGTGCAAGCAC ATTGGTCTCAATCTTTGCTGCAGATAAGGTTGCGAGGAGGATTCTGCTTCTTCAAGCCTGCGTGCAGATGTTCATAA
AA sequence Show only first row Show all	>Potri.008G150901.1 pacid=42808542 polypeptide=Potri.008G150901.1.p locus=Potri.008G150901 ID=Potri.008G150901.1.v4.1 annot-version=v4.1 MHPNGWRVFLGLAGVPAFVLFIGSIVITGTPTSLIECGNETAGKSTLRKIRGVDHVNAEFEQFKAASEIARQVRHPYKKTMKCSSMPTLVIGIQLQIFHQ LTGIDAVMFYALGFKNDASLLSAVITGIVNVQAHWSQSLLQIRLRGGFCFFKPACRCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26250			Major facilitator superfamily ...		Potri.008G150901 [exp]	0	1
					Potri.010G007402 [exp]	15.06	0.9083
AT1G22240		APUM8	pumilio 8 (.1)		Potri.011G144000 [exp]	28.87	0.7650
AT4G05230			Ubiquitin-like superfamily pro...		Potri.004G022400 [exp]	58.60	0.9083
AT5G18990			Pectin lyase-like superfamily ...		Potri.004G033700 [exp]	60.53	0.9083
AT3G02310	MADS	AGL4, SEP2	SEPALLATA 2, AGAMOUS-like 4, K...		Potri.004G115500 [exp]	62.39	0.9083
					Potri.009G140750 [exp]	78.63	0.9083
					Potri.011G087050 [exp]	81.49	0.9083
					Potri.015G064900 [exp]	95.70	0.9083
AT2G24370			Protein kinase protein with ad...		Potri.018G002400 [exp]	101.51	0.9083
					Potri.001G169351 [exp]	108.06	0.9083

Compare expression of checked genes

Potri.008G150901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.