Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32090 139 / 1e-42 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT4G14850 103 / 7e-26 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G37310 70 / 3e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 64 / 3e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT4G13650 63 / 7e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G04780 61 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G56310 61 / 4e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59200 61 / 5e-11 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G50990 60 / 6e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G43790 60 / 7e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G087000 [exp] 175 / 5e-57 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.010G086900 [exp] 117 / 5e-31 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G141200 [exp] 66 / 5e-13 AT5G66520 407 / 1e-135 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G369900 [exp] 63 / 4e-12 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G035900 [exp] 61 / 2e-11 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G047800 [exp] 61 / 4e-11 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G044700 [exp] 61 / 4e-11 AT3G22690 582 / 0.0 unknown protein Potri.006G207500 [exp] 60 / 5e-11 AT5G37570 602 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.005G012600 [exp] 60 / 5e-11 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006122 [exp] 156 / 2e-49 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10010552 [exp] 152 / 1e-47 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10006123 [exp] 105 / 9e-27 AT4G14850 923 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010551 [exp] 90 / 3e-21 AT4G14850 668 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10023592 [exp] 63 / 9e-12 AT1G74630 840 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013319 [exp] 62 / 2e-11 AT4G21065 744 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10004081 [exp] 60 / 7e-11 AT3G63370 893 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005207 [exp] 60 / 8e-11 AT4G21065 741 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10015225 [exp] 60 / 1e-10 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038400 [exp] 60 / 1e-10 AT3G57430 1097 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [poplar] [flax] Glyoxalase PF12681 [poplar] [flax] Glyoxalase_2 Glyoxalase-like domain
Representative CDS sequence Show only first row Show all	>Potri.008G153602.1 pacid=42808010 polypeptide=Potri.008G153602.1.p locus=Potri.008G153602 ID=Potri.008G153602.1.v4.1 annot-version=v4.1 ATGAGGAACAGGTACATGATTGAATCGGGAGCTGAGCATTATGCTTGTACTGTGGACATGTTATGGCGGGCTGGAATGGTGGAGCTTGCTTATGAATTTG TACAGAAAATGCCAATTCAAAATTCAGGCAACCATGTGCTGCTTTCAAACATGTTAGTTGTTGTTGAAAGATGGGAGGAAGCCACCCTTGTGAGAAAAGA ATTGAAGGATGTTGGGATCAAGAAGGGGGCAGGTCTCTCCAGATTTCGCTTCCACTTAATCGAAAGGAGCCCAGATACCCAGCTTCCTGAAGGACCCTAC AGTGCCGCTTCACCGGTTCTTGATCCTACCCATCTCCCTAGAGGACATCATGTCTGCTTCTCTGTCTCTAATTTTGACTCCTTTGTCCAATCTCTCAAGG ACAAGGGAATAAAAACGTTTCAGAGGTCTGTACCTAATCGGCCAATCAGGCAGGTCTTCTTCTTTGATCCAGATGGTAATGGATTGGAAGTTGCGAGTCG TGATGAATAG
AA sequence Show only first row Show all	>Potri.008G153602.1 pacid=42808010 polypeptide=Potri.008G153602.1.p locus=Potri.008G153602 ID=Potri.008G153602.1.v4.1 annot-version=v4.1 MRNRYMIESGAEHYACTVDMLWRAGMVELAYEFVQKMPIQNSGNHVLLSNMLVVVERWEEATLVRKELKDVGIKKGAGLSRFRFHLIERSPDTQLPEGPY SAASPVLDPTHLPRGHHVCFSVSNFDSFVQSLKDKGIKTFQRSVPNRPIRQVFFFDPDGNGLEVASRDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32090			Lactoylglutathione lyase / gly...		Potri.008G153602 [exp]	0	1
AT1G03670			ankyrin repeat family protein ...		Potri.013G133800 [exp]	32.92	0.8617
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Potri.014G124100 [exp]	50.07	0.8515
AT3G04480			endoribonucleases (.1)		Potri.013G047400 [exp]	84.14	0.8381
AT1G53430			Leucine-rich repeat transmembr...		Potri.010G155800 [exp]	103.24	0.8293
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Potri.015G106900 [exp]	145.54	0.8204	Pt-LEAFY.1
AT5G45480			Protein of unknown function (D...		Potri.006G013400 [exp]	172.39	0.7945
AT1G01380	MYB	ETC1	ENHANCER OF TRY AND CPC 1, Hom...		Potri.011G026300 [exp]	185.93	0.8105
AT5G14090			unknown protein		Potri.001G059100 [exp]	202.58	0.7922

Compare expression of checked genes

Potri.008G153602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.