Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14820 79 / 9e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G08070 66 / 2e-13 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48910 59 / 5e-11 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G14850 58 / 1e-10 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G77170 57 / 4e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G02980 56 / 1e-09 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G40720 55 / 1e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G12770 54 / 3e-09 MEF22 mitochondrial editing factor 22 (.1) AT5G56310 54 / 4e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G38010 54 / 4e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G086200 [exp] 154 / 1e-44 AT4G14820 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G040100 [exp] 64 / 1e-12 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G220600 [exp] 64 / 1e-12 AT3G26630 481 / 2e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G191200 [exp] 62 / 4e-12 AT5G48910 852 / 0.0 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G083700 [exp] 60 / 3e-11 AT3G22690 1050 / 0.0 unknown protein Potri.016G096400 [exp] 59 / 8e-11 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G077700 [exp] 57 / 4e-10 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G086900 [exp] 56 / 9e-10 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G047800 [exp] 56 / 1e-09 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021069 [exp] 60 / 4e-11 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021068 [exp] 60 / 4e-11 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017243 [exp] 60 / 4e-11 AT1G13410 539 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030053 [exp] 58 / 1e-10 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014298 [exp] 58 / 2e-10 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010902 [exp] 57 / 3e-10 AT4G18840 148 / 2e-41 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10033858 [exp] 57 / 4e-10 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026006 [exp] 57 / 5e-10 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040680 [exp] 56 / 7e-10 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007341 [exp] 56 / 1e-09 AT2G42920 610 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.008G154301.1 pacid=42807222 polypeptide=Potri.008G154301.1.p locus=Potri.008G154301 ID=Potri.008G154301.1.v4.1 annot-version=v4.1 ATGTCACTGCCCACTGCTTTGCTGTCTGCGCTGCAGGTTGAAGATGGCTTGCTTGGTACTGACAGTTTTAGCTTTCCTTCATTGCTGAAGGCAGCTTCCA GAACTTCTGGGTTGATTGAAGGGAAGGAGATTCATGGGATTGCGGCTAAATTGTGTTTTGATAAAGATCCTTTTGTTCGAATGGGCTTGGTGGGCTTGTA CTATCAGAGTGGACTTTATGATGATGTGTTGCAGCTTTTTGAAGAGATGAGGAATTCCAATTTGAAGCCAGGTGAAAAGAGTGCACTGGTTACCATGTAT GCAAGCTGTGGCTGTTTGGATATTGCTGAAGAATTATTTACTAAGATCTCAACAAAGAACTTGGTTGTTTTAAGTTTTAACAGCCATGGTTTCTGGGTAT TCGAGAGTTGGGAGAGTTGA
AA sequence Show only first row Show all	>Potri.008G154301.1 pacid=42807222 polypeptide=Potri.008G154301.1.p locus=Potri.008G154301 ID=Potri.008G154301.1.v4.1 annot-version=v4.1 MSLPTALLSALQVEDGLLGTDSFSFPSLLKAASRTSGLIEGKEIHGIAAKLCFDKDPFVRMGLVGLYYQSGLYDDVLQLFEEMRNSNLKPGEKSALVTMY ASCGCLDIAEELFTKISTKNLVVLSFNSHGFWVFESWES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14820			Pentatricopeptide repeat (PPR)...		Potri.008G154301 [exp]	0	1
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Potri.015G014900 [exp]	2.44	0.7873
AT5G24750			UDP-Glycosyltransferase superf...		Potri.003G021100 [exp]	17.86	0.7134
AT1G04270		RPS15	cytosolic ribosomal protein S1...		Potri.005G055534 [exp]	19.10	0.7352
AT3G13226			regulatory protein RecX family...		Potri.001G467400 [exp]	21.72	0.7155
AT4G08210			Pentatricopeptide repeat (PPR-...		Potri.002G087400 [exp]	27.71	0.7393
AT1G02120		VAD1	VASCULAR ASSOCIATED DEATH1, GR...		Potri.002G137800 [exp]	28.21	0.7384
AT3G62970			zinc finger (C3HC4-type RING f...		Potri.014G134400 [exp]	33.04	0.7065
AT3G60500		G3, CER7	ECERIFERUM 7, 3'-5'-exoribonuc...		Potri.009G047500 [exp]	55.08	0.6733
AT3G49430		SRP34A, SR34a, ...	Serine/Arginine-Rich Protein S...		Potri.015G004600 [exp]	56.28	0.6511
AT1G56190			Phosphoglycerate kinase family...		Potri.016G091800 [exp]	56.28	0.6915

Compare expression of checked genes

Potri.008G154301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.