Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48140 122 / 1e-34 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G05450 119 / 2e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 117 / 9e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 61 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 60 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 54 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 50 / 9e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 46 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 46 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 45 / 5e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085200 [exp] 248 / 7e-84 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G212000 [exp] 131 / 4e-38 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 120 / 6e-34 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050400 [exp] 56 / 2e-09 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 55 / 2e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 54 / 3e-09 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G196000 [exp] 54 / 1e-08 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G169000 [exp] 52 / 3e-08 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 51 / 9e-08 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010575 [exp] 125 / 1e-35 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10021911 [exp] 117 / 8e-33 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041196 [exp] 117 / 1e-32 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014683 [exp] 109 / 2e-28 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 100 / 4e-27 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022067 [exp] 99 / 2e-25 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042613 [exp] 88 / 9e-22 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 56 / 2e-09 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 54 / 5e-09 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 53 / 3e-08 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.008G155200.1 pacid=42806441 polypeptide=Potri.008G155200.1.p locus=Potri.008G155200 ID=Potri.008G155200.1.v4.1 annot-version=v4.1 ATGCACCATAATTTCCTTCACTCTTCTCCAACAAGTATTGATCCTCGCTACAAGAACACCCATTCCCACATGGAGCGTTTTGTGCCTTTTCCGCGTACGG TTCCCTTTCTGGCTGTTGCTCTGGCAGTCTTTGTTTTTCCTGTTTATGGCCAGATCAATGCTGCGTGCACGGCTTCGGTGCTTGCTACCTTCGCCCCATG TATGACTTTTCTTACAAGTAGTACCGCCAATGGTTCTTCGCCAACTGCCGGCTGTTGCGGTTCACTTAAGAACCTGACAAGTGATGGGATGGACTGTTTG TGTCTTGTTGTAACTGGAAGCGTTCCCTTCGGCGTACCAATCAATAGAACGTTAGCCATCTCTCTGCCTCGTGCCTGTAACATGCCTGGCGTCCCAGTCC AATGCGAAGCCACCGGTGCACCAATTCCTGCTCCAGCTTCTGTTGTTCCTGAACCAACTCCATCCGCTCTACCACCAGCATCTGGCACGACACCTCTCCT GGCTCCACCGTCATCGACGGGAGATTCTGGGGCACCGGCATCAACTACTGGGAGTCACCCAATTCTAACTCCACCATCAGCATCAGTGCCCTCCGACAGC CTTTCACCATCTCTTCTACTATTTGCATTAGGATTTGTACTTTTCAAGTACTACTACTAG
AA sequence Show only first row Show all	>Potri.008G155200.1 pacid=42806441 polypeptide=Potri.008G155200.1.p locus=Potri.008G155200 ID=Potri.008G155200.1.v4.1 annot-version=v4.1 MHHNFLHSSPTSIDPRYKNTHSHMERFVPFPRTVPFLAVALAVFVFPVYGQINAACTASVLATFAPCMTFLTSSTANGSSPTAGCCGSLKNLTSDGMDCL CLVVTGSVPFGVPINRTLAISLPRACNMPGVPVQCEATGAPIPAPASVVPEPTPSALPPASGTTPLLAPPSSTGDSGAPASTTGSHPILTPPSASVPSDS LSPSLLLFALGFVLFKYYY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G48140		EDA4	embryo sac development arrest ...		Potri.008G155200 [exp]	0	1
AT5G66440			unknown protein		Potri.005G229800 [exp]	1.00	0.9540
					Potri.017G080900 [exp]	4.69	0.9431
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Potri.017G099500 [exp]	5.47	0.9269
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.005G006800 [exp]	8.94	0.9268
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Potri.011G040300 [exp]	8.94	0.9191
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075600 [exp]	8.94	0.9064
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075400 [exp]	10.58	0.9161	BGIT.1
AT1G73260		ATKTI1	ARABIDOPSIS THALIANA KUNITZ TR...		Potri.007G111500 [exp]	12.12	0.8697
AT2G46150			Late embryogenesis abundant (L...		Potri.002G165100 [exp]	12.24	0.9040
AT3G22060			Receptor-like protein kinase-r...		Potri.017G040132 [exp]	12.96	0.8979

Compare expression of checked genes

Potri.008G155200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.