Potri.008G155300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14805 59 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G085000 124 / 7e-37 AT4G14805 105 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010576 69 / 7e-15 AT4G14805 87 / 5e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10021910 59 / 2e-11 AT4G14805 81 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF14368 LTP_2 Probable lipid transfer
Representative CDS sequence
>Potri.008G155300.2 pacid=42808856 polypeptide=Potri.008G155300.2.p locus=Potri.008G155300 ID=Potri.008G155300.2.v4.1 annot-version=v4.1
ATGAGTTGGTGGCCTTCTCTCCCTGTCTCGGCACCGCCAGACAGAGTCACAGACACTGCAACATCTCAGCGCTGCGATGCCTTGTCTAAGGCATTCAATT
CCGGTGATGGCAACTGTTTCTGTTACCTAATCAGGCAGCCTCTAATCTTCGGATTCCCATTGAACGAACCCAGAGTGATTGCTTTACCTTCTGTTTGCTC
TCTATCTAGTCCTGTATCTTTAGATTTGCTCTGCTCAGGTTCACCAGCACTGCCCCCCTTCACGGCACAACAACTCCAGAGTCCTGATGATCTTTCATTA
GCACCAAGTTTGCCACCAGAATCTGTTGATGGATCACCCAGAAGCCCAGTTTCGCCTCTAGCACCAGCAGAGAAGCATAACAGCAACAGCTAG
AA sequence
>Potri.008G155300.2 pacid=42808856 polypeptide=Potri.008G155300.2.p locus=Potri.008G155300 ID=Potri.008G155300.2.v4.1 annot-version=v4.1
MSWWPSLPVSAPPDRVTDTATSQRCDALSKAFNSGDGNCFCYLIRQPLIFGFPLNEPRVIALPSVCSLSSPVSLDLLCSGSPALPPFTAQQLQSPDDLSL
APSLPPESVDGSPRSPVSPLAPAEKHNSNS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14805 Bifunctional inhibitor/lipid-t... Potri.008G155300 0 1
AT5G45480 Protein of unknown function (D... Potri.015G113700 9.27 0.7817
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Potri.017G037900 12.80 0.7636
AT5G03620 Subtilisin-like serine endopep... Potri.006G114500 28.91 0.7195
AT5G25570 unknown protein Potri.006G245100 31.19 0.7473
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Potri.013G149000 33.27 0.7415
AT5G45470 Protein of unknown function (D... Potri.015G113400 40.00 0.7394
AT2G22900 Galactosyl transferase GMA12/M... Potri.014G006100 42.35 0.7312 GT6.2
AT1G05610 APS2 ADP-glucose pyrophosphorylase ... Potri.007G146100 42.52 0.7433
Potri.014G194201 52.01 0.6829
AT2G03550 alpha/beta-Hydrolases superfam... Potri.009G105100 59.57 0.6848

Potri.008G155300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.