Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PBD2.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 364 / 6e-130 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 353 / 1e-125 PBD2 20S proteasome beta subunit D2 (.1.2) AT1G53850 67 / 2e-13 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 66 / 7e-13 PAE2 20S proteasome alpha subunit E2 (.1) AT3G26340 58 / 5e-10 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G13060 58 / 6e-10 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G60820 51 / 8e-08 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 48 / 1e-06 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 47 / 2e-06 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G22110 46 / 4e-06 PAC1 20S proteasome alpha subunit C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G084800 [exp] 410 / 3e-148 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.001G162900 [exp] 64 / 2e-12 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 61 / 4e-11 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.008G177000 [exp] 56 / 2e-09 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.010G058100 [exp] 55 / 5e-09 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.014G069800 [exp] 52 / 3e-08 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 52 / 4e-08 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G037700 [exp] 49 / 5e-07 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1) Potri.004G066000 [exp] 49 / 5e-07 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039351 [exp] 377 / 5e-135 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10041194 [exp] 369 / 7e-132 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10021909 [exp] 366 / 8e-131 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1) Lus10006596 [exp] 186 / 5e-61 AT3G22630 168 / 2e-54 20S proteasome beta subunit D1 (.1) Lus10003936 [exp] 64 / 1e-11 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 63 / 1e-11 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10006426 [exp] 54 / 2e-08 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 52 / 6e-08 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10014581 [exp] 50 / 3e-07 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10032102 [exp] 49 / 5e-07 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.008G155500.1 pacid=42808229 polypeptide=Potri.008G155500.1.p locus=Potri.008G155500 ID=Potri.008G155500.1.v4.1 annot-version=v4.1 ATGGAGTGCGTATTCGGACTTGTGGGTAATGATTTCGTAATCGTAGTAGCAGACACATCTGCCGTTAACAGCATCTTGGTCCATAAAACCAACGAAGACA AGATTATGAAACTCGACTCTCACAAGCTCATCGCTGCTAGCGGTGAGTCCGGTGACCGAGTTCAATTCACGGAGTATATTCAGAAGAACGTGGCTTTGTA TCATTTCCGTAATGGGATTCCCTTGACCACCGCAGCTGCTGCTAATTTTACCCGTGGAGAGCTCGCTACTGCTTTGAGAAAGAACCCTTACATGGTAAAC ATCCTACTGGCTGGCTTTGACAGAGAGACAGGCCCCTCTCTATACTACATCGACTATATTGCTACCCTTCACAAGGTTGACAAGGGAGCATTTGGTTACG GGTCCTTTTTTTGTCTCTCCATGATGGACAGACACTACCACAGTGGTATGTCAGTGGAAGAGGCAGTTGAATTGGTTGATAAATGCATAATGGAGATTCG ATCCAGGTTGGTTGTGGCGCCACCGAACTTTGTGATCAAGATTGTTGACAGGGATGGAGCAAGAGAGTATGCCTGGCGTGAATCTGTCAAGGATACCCCA ACAGCCCAGTCCGAGGGTTTGGCAGTTTAA
AA sequence Show only first row Show all	>Potri.008G155500.1 pacid=42808229 polypeptide=Potri.008G155500.1.p locus=Potri.008G155500 ID=Potri.008G155500.1.v4.1 annot-version=v4.1 MECVFGLVGNDFVIVVADTSAVNSILVHKTNEDKIMKLDSHKLIAASGESGDRVQFTEYIQKNVALYHFRNGIPLTTAAAANFTRGELATALRKNPYMVN ILLAGFDRETGPSLYYIDYIATLHKVDKGAFGYGSFFCLSMMDRHYHSGMSVEEAVELVDKCIMEIRSRLVVAPPNFVIKIVDRDGAREYAWRESVKDTP TAQSEGLAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Potri.008G155500 [exp]	0	1	Pt-PBD2.3
AT1G21720		PBC1	proteasome beta subunit C1 (.1...		Potri.005G180500 [exp]	1.00	0.9205	Pt-PBC2.1
AT3G12260			LYR family of Fe/S cluster bio...		Potri.001G029900 [exp]	4.00	0.9094
AT2G20820			unknown protein		Potri.019G109100 [exp]	4.24	0.9106
AT1G04630		MEE4	maternal effect embryo arrest ...		Potri.003G173800 [exp]	4.58	0.9068
AT4G11150		TUFF, EMB2448, ...	embryo defective 2448, vacuola...		Potri.013G051500 [exp]	6.16	0.9179
AT5G67590		FRO1	FROSTBITE1, NADH-ubiquinone ox...		Potri.007G005100 [exp]	8.36	0.9007
AT1G67785			unknown protein		Potri.015G087301 [exp]	8.48	0.9023
AT2G47320			Cyclophilin-like peptidyl-prol...		Potri.002G194250 [exp]	12.40	0.9048
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Potri.007G079500 [exp]	13.22	0.8862
AT4G17510		UCH3	ubiquitin C-terminal hydrolase...		Potri.003G081000 [exp]	14.83	0.8732

Compare expression of checked genes

Potri.008G155500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.