Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04190 539 / 0 TPR3 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62740 100 / 3e-23 Hop2 Hop2, stress-inducible protein, putative (.1) AT1G12270 95 / 2e-21 Hop1 Hop1, stress-inducible protein, putative (.1) AT4G12400 92 / 2e-20 Hop3 Hop3, stress-inducible protein, putative (.1.2) AT3G04710 77 / 3e-15 TPR10 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) AT2G42810 76 / 4e-15 AtPP5, PP5.2, PP5, PAPP5 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2) AT5G09420 75 / 1e-14 MTOM64, ATTOC64-V, AtmtOM64 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) AT3G17970 73 / 5e-14 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT1G53300 72 / 1e-13 TTL1 tetratricopetide-repeat thioredoxin-like 1 (.1) AT3G14950 67 / 5e-12 TTL2 tetratricopetide-repeat thioredoxin-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G082900 [exp] 642 / 0 AT1G04190 540 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G113400 [exp] 96 / 7e-22 AT4G12400 830 / 0.0 Hop3, stress-inducible protein, putative (.1.2) Potri.001G119500 [exp] 96 / 1e-21 AT4G12400 864 / 0.0 Hop3, stress-inducible protein, putative (.1.2) Potri.012G046900 [exp] 81 / 8e-17 AT3G17970 744 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Potri.013G042300 [exp] 81 / 1e-16 AT3G04710 619 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Potri.005G054800 [exp] 79 / 5e-16 AT3G04710 611 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) Potri.015G038600 [exp] 77 / 2e-15 AT3G17970 747 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Potri.001G205300 [exp] 75 / 1e-14 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) Potri.014G141800 [exp] 74 / 2e-14 AT2G42810 895 / 0.0 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041189 [exp] 539 / 0 AT1G04190 516 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021905 [exp] 530 / 0 AT1G04190 515 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032234 [exp] 95 / 3e-21 AT1G62740 892 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10028919 [exp] 95 / 3e-21 AT1G62740 890 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10024597 [exp] 94 / 7e-21 AT1G62740 886 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10004336 [exp] 92 / 3e-20 AT1G62740 873 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10018004 [exp] 82 / 7e-17 AT3G17970 711 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10042001 [exp] 81 / 2e-16 AT3G17970 714 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10009682 [exp] 80 / 3e-16 AT3G17970 700 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10006559 [exp] 75 / 1e-14 AT3G04710 581 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF00515 [poplar] [flax] TPR_1 Tetratricopeptide repeat CL0020 [poplar] [flax] TPR PF13414 [poplar] [flax] TPR_11 TPR repeat
Representative CDS sequence Show only first row Show all	>Potri.008G156500.1 pacid=42806162 polypeptide=Potri.008G156500.1.p locus=Potri.008G156500 ID=Potri.008G156500.1.v4.1 annot-version=v4.1 ATGGCCGAAGCAGAGAAAGGATCAGCTACGACAGGCTCCAACGAAGGTAATGGTAAGGAGGAGATATCATTGAAAGACAAAGGCAATGAATTCTTTAAAG CAGGGAACTATCTCAAAGCTGCTGCTCTTTATACTCAGGCTATCAAGCTTGACCCTTCAAATCCCACTCTTTATAGCAATCGTGCTGCAGCATTTTTGCA ATTGGTCAAGCTTAATAAAGCACTTGCTGATGCCGAGACAACTATCACATTGAATCCTCAATGGGAAAAGGGATATTTCAGGAAAGGGTGTGTATTAGAG GCCATGGAACAGTATGATAATGCATTGGCTACTTTTCAAATAGCTTTACAATACAATCCACGGAGCACTGAAGTATCAAGAAAGATTAAGAGGATATCCC AGTTGGCCAAAGACAAAAAACGAGCTCAAGAGGTTGAGAGCATGAGATCCAATGTTAACATGGAAAAACACTTGGAAACATTGAAATCTGAAATGTCTGA AATGCTTGGATCCGAAGAATGTTTTAAAGAAATGTTCTCCTTTCTTGTTGAGACTATGGAGACAGCTGTAAAATCATGGCATGAAGCTTCTAAAGTGGAT CCTAGAGTCTACTTTCTTCTTGACAAGGAAAAGACACTAACTGATAAATATGCTCCAGTTGTCAATATTGACAAGGCCTTTGAATCACCCCATACACATG GCAATTGCTTCTCATTTCTTAGGCAATATGCGGAGGATTCTTTCTCCAAGGCAGCTTGCGTAGTGGTGCCAAAGAATATCATATCTTATCCACAGGTTTG GAAAGGTCAAGGATCAAGAAAGTGGAGGCATGGGCAGCATGATGGCATCTTCGTTCAATATGAGTCACCTTTAATGCGAAAAATATGGTTTATTGCTAGC AGCAATGAAAAGGGGCAAACACTGTGCAGGGATCCAGAGATTCTAGATATTAGTGCTCATGAAGTGCTGCCACGCCTTTTCAAAGAAAAGATGCCAAATC CTTAA
AA sequence Show only first row Show all	>Potri.008G156500.1 pacid=42806162 polypeptide=Potri.008G156500.1.p locus=Potri.008G156500 ID=Potri.008G156500.1.v4.1 annot-version=v4.1 MAEAEKGSATTGSNEGNGKEEISLKDKGNEFFKAGNYLKAAALYTQAIKLDPSNPTLYSNRAAAFLQLVKLNKALADAETTITLNPQWEKGYFRKGCVLE AMEQYDNALATFQIALQYNPRSTEVSRKIKRISQLAKDKKRAQEVESMRSNVNMEKHLETLKSEMSEMLGSEECFKEMFSFLVETMETAVKSWHEASKVD PRVYFLLDKEKTLTDKYAPVVNIDKAFESPHTHGNCFSFLRQYAEDSFSKAACVVVPKNIISYPQVWKGQGSRKWRHGQHDGIFVQYESPLMRKIWFIAS SNEKGQTLCRDPEILDISAHEVLPRLFKEKMPNP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04190		TPR3	tetratricopeptide repeat 3, Te...		Potri.008G156500 [exp]	0	1
AT2G34050			unknown protein		Potri.004G052200 [exp]	10.29	0.7624
AT2G01720			Ribophorin I (.1)		Potri.008G038700 [exp]	13.85	0.7540
AT3G03420			Ku70-binding family protein (....		Potri.017G120800 [exp]	18.57	0.6845
AT2G45060			Uncharacterised conserved prot...		Potri.014G058700 [exp]	23.49	0.7176
AT1G20200		HAP15, EMB2719	HAPLESS 15, EMBRYO DEFECTIVE 2...		Potri.009G136900 [exp]	24.97	0.7421
AT2G18465			Chaperone DnaJ-domain superfam...		Potri.019G010000 [exp]	36.60	0.6866
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Potri.007G070000 [exp]	43.05	0.7221
AT1G04990	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.014G159500 [exp]	52.04	0.6636	Pt-ZFN2.1
AT1G50670			OTU-like cysteine protease fam...		Potri.001G435500 [exp]	55.85	0.7228
AT1G67620			Lojap-related protein (.1)		Potri.008G105700 [exp]	60.48	0.6908

Compare expression of checked genes

Potri.008G156500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.