Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23770 66 / 3e-12 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT3G01840 49 / 2e-06 Protein kinase superfamily protein (.1) AT1G51940 45 / 2e-05 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT2G17120 45 / 3e-05 LYM2 lysm domain GPI-anchored protein 2 precursor (.1) AT1G77630 43 / 0.0001 LYM3 lysin-motif \(LysM\) domain protein 3, Peptidoglycan-binding LysM domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G160600 [exp] 375 / 7e-128 AT2G33580 217 / 8e-62 Protein kinase superfamily protein (.1) Potri.010G078700 [exp] 342 / 8e-115 AT2G23770 288 / 5e-89 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128501 [exp] 152 / 9e-46 AT2G23770 71 / 4e-14 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.007G032300 [exp] 152 / 1e-42 AT2G33580 247 / 6e-73 Protein kinase superfamily protein (.1) Potri.001G332800 [exp] 72 / 3e-14 AT3G01840 471 / 4e-158 Protein kinase superfamily protein (.1) Potri.005G259600 [exp] 72 / 4e-14 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.005G128200 [exp] 66 / 2e-12 AT2G23770 514 / 4e-176 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 63 / 3e-11 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G040000 [exp] 59 / 7e-10 AT2G23770 345 / 1e-110 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021889 [exp] 176 / 7e-52 AT2G23770 256 / 2e-77 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10016793 [exp] 127 / 3e-33 AT3G21630 222 / 9e-64 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Lus10022487 [exp] 123 / 9e-32 AT5G66631 707 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039406 [exp] 77 / 8e-16 AT2G33580 229 / 4e-68 Protein kinase superfamily protein (.1) Lus10016299 [exp] 74 / 9e-15 AT2G23770 368 / 3e-119 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10022345 [exp] 73 / 2e-14 AT3G01840 429 / 1e-141 Protein kinase superfamily protein (.1) Lus10008105 [exp] 72 / 5e-14 AT1G16120 419 / 3e-137 wall associated kinase-like 1 (.1) Lus10041171 [exp] 69 / 3e-13 AT2G33580 224 / 1e-64 Protein kinase superfamily protein (.1) Lus10004504 [exp] 68 / 9e-13 AT1G16130 411 / 5e-134 wall associated kinase-like 2 (.1) Lus10008586 [exp] 62 / 1e-10 AT2G33580 594 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [poplar] [flax] LysM PF01476 [poplar] [flax] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Potri.008G160501.1 pacid=42808222 polypeptide=Potri.008G160501.1.p locus=Potri.008G160501 ID=Potri.008G160501.1.v4.1 annot-version=v4.1 ATGAGACCCGCATCCCGTTTAGTCTCTTCTCTCTTCTTCTTTCTCTCTTACAGTAATATCCTCCACCACTTGCAAGCCCAGCCAAGCACTCAAGGGTTCA CCTGCCCAGCCAACCAGAGGTCCTTTCCATGTCAAACCTATGCCTTCTACCGAGCCTCAGCTCCTAACTTCCTTGACCTTGCCTCAATCGGTGACCTTTT CTCGGTTAGCCGCCTTATGATATCAAAACCAAGTAACATCTCCTCTCCAACCTCACCTCTCATCCCCAATCAACCCCTCTTTGTCCCTTTATCATGTTCT TGCAACACCATCAATATTAGCACTAGCATTTCCTCTGCAAATATCACATATACCATCAAGGAAGGCAACACTTTCTACATTGTCTCGACTAAATACTTCC AAAACCTTACGACCTACCAGTCAGTTGAGCTTTTCAACCCTACACTTATCCCCGAACTACTCGACATAGGAGTAGAGGTGATCTTTCCAATATTTTGCAA GTGTCCTCATCAAACCCAGTTGCAAAACAAGGTGAATTATCTGGTATCTTATGTGTTTCAGCCTTCTGATAACTTATCTTCAGTTGCTTCAACATTTGGA GTTGAAACACAATCTATTGTTGATGTTAATGGCAATAACATCCAGCCTTATGATACCATATTCGTTCCAGTCTATCAACTTCCACAACTGGCACAACCTA CAGATAGAGCATTGAAAGTTAACAGAATTGGAACCTGA
AA sequence Show only first row Show all	>Potri.008G160501.1 pacid=42808222 polypeptide=Potri.008G160501.1.p locus=Potri.008G160501 ID=Potri.008G160501.1.v4.1 annot-version=v4.1 MRPASRLVSSLFFFLSYSNILHHLQAQPSTQGFTCPANQRSFPCQTYAFYRASAPNFLDLASIGDLFSVSRLMISKPSNISSPTSPLIPNQPLFVPLSCS CNTINISTSISSANITYTIKEGNTFYIVSTKYFQNLTTYQSVELFNPTLIPELLDIGVEVIFPIFCKCPHQTQLQNKVNYLVSYVFQPSDNLSSVASTFG VETQSIVDVNGNNIQPYDTIFVPVYQLPQLAQPTDRALKVNRIGT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G23770			protein kinase family protein ...		Potri.008G160501 [exp]	0	1
AT4G04220		AtRLP46	receptor like protein 46 (.1)		Potri.001G003200 [exp]	3.60	0.7863
AT1G23210		ATGH9B6	glycosyl hydrolase 9B6 (.1)		Potri.015G127900 [exp]	9.05	0.7843
AT4G27290			S-locus lectin protein kinase ...		Potri.001G411100 [exp]	10.09	0.7686
AT4G18170	WRKY	ATWRKY28, WRKY2...	WRKY DNA-binding protein 28 (....		Potri.002G059100 [exp]	13.74	0.7174
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Potri.002G026100 [exp]	18.52	0.7552
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Potri.002G263600 [exp]	20.00	0.7483
AT2G27480			Calcium-binding EF-hand family...		Potri.004G202200 [exp]	22.64	0.7489
AT2G46550			unknown protein		Potri.002G173200 [exp]	23.23	0.7411
AT5G18980			ARM repeat superfamily protein...		Potri.008G200500 [exp]	26.83	0.7053
AT4G27290			S-locus lectin protein kinase ...		Potri.001G412454 [exp]	27.22	0.7239

Compare expression of checked genes

Potri.008G160501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.