Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08070 63 / 1e-12 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09190 58 / 7e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G39350 52 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G04780 51 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09410 51 / 2e-08 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G13770 50 / 3e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G63370 50 / 5e-08 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G29760 48 / 2e-07 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G26782 48 / 3e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G06540 47 / 3e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G040100 [exp] 59 / 4e-11 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G245300 [exp] 57 / 1e-10 AT3G22690 570 / 0.0 unknown protein Potri.005G012600 [exp] 54 / 1e-09 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G051300 [exp] 54 / 1e-09 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G044700 [exp] 53 / 5e-09 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G175900 [exp] 52 / 5e-09 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G018800 [exp] 52 / 7e-09 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G153700 [exp] 52 / 7e-09 AT3G04750 341 / 8e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G223900 [exp] 52 / 9e-09 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033026 [exp] 61 / 1e-11 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 58 / 6e-11 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030053 [exp] 58 / 6e-11 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005987 [exp] 57 / 1e-10 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004987 [exp] 54 / 2e-09 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031423 [exp] 54 / 2e-09 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010909 [exp] 54 / 2e-09 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 54 / 2e-09 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031989 [exp] 53 / 4e-09 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013176 [exp] 52 / 7e-09 AT5G39350 621 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G161001.1 pacid=42807771 polypeptide=Potri.008G161001.1.p locus=Potri.008G161001 ID=Potri.008G161001.1.v4.1 annot-version=v4.1 ATGATCATGGAATTCAATCAGTGGAAAAGCTCTATGCCGGTGTTGTTGATGACCTTCTTAGTCATGCTAGGTGCCTTGAATAAGCATATAACCTTGTTAG TAGCGCAGCAGTCATGCTGGGTTCATCACAAGATTCAATTGGCTGAAATTTCAGGAGCTGCGTTAATCAAGATCGAGTCTGATAATTCTGGTAATCTTGT TCTTTTGTCTGATATCCATGCAGTTGCTGGAAGATCAGATCATGTTGCTAAATTGAGAGCAATGATCTGGGAGAACCAAATTAGAAAGCATAGAATTTCC AGCCGATTTGAGTTGGGAAGTGTTATCCATGAAGCTTCATGA
AA sequence Show only first row Show all	>Potri.008G161001.1 pacid=42807771 polypeptide=Potri.008G161001.1.p locus=Potri.008G161001 ID=Potri.008G161001.1.v4.1 annot-version=v4.1 MIMEFNQWKSSMPVLLMTFLVMLGALNKHITLLVAQQSCWVHHKIQLAEISGAALIKIESDNSGNLVLLSDIHAVAGRSDHVAKLRAMIWENQIRKHRIS SRFELGSVIHEAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G08070		EMB3102, OTP82	ORGANELLE TRANSCRIPT PROCESSIN...		Potri.008G161001 [exp]	0	1
					Potri.002G216266 [exp]	24.24	0.5566
AT5G25160	C2H2ZnF	ZFP3	zinc finger protein 3 (.1)		Potri.018G123900 [exp]	56.85	0.5851

Compare expression of checked genes

Potri.008G161001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.