Potri.008G162600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14500 580 / 0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT3G23080 538 / 0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT1G64720 332 / 4e-111 CP5 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G54170 327 / 4e-108 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G13062 126 / 3e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
AT1G55960 120 / 8e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G076500 686 / 0 AT4G14500 571 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.015G005000 356 / 2e-119 AT1G64720 474 / 1e-166 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.011G151500 354 / 3e-119 AT1G64720 515 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.012G021400 349 / 1e-116 AT1G64720 478 / 2e-168 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.001G450100 343 / 1e-114 AT1G64720 489 / 6e-173 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.007G002700 124 / 2e-31 AT3G13062 390 / 5e-134 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Potri.014G001100 124 / 2e-31 AT3G13062 416 / 3e-144 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041166 606 / 0 AT4G14500 607 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10021883 592 / 0 AT4G14500 605 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10033247 325 / 1e-107 AT1G64720 523 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10032938 315 / 2e-103 AT1G64720 437 / 2e-152 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008281 255 / 9e-83 AT1G64720 374 / 1e-130 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10033334 114 / 7e-28 AT1G55960 384 / 5e-132 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10034791 95 / 6e-21 AT3G13062 346 / 2e-115 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Lus10000083 62 / 7e-11 AT3G23080 122 / 6e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10015566 49 / 1e-06 AT1G64720 105 / 5e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF01852 START START domain
Representative CDS sequence
>Potri.008G162600.1 pacid=42807184 polypeptide=Potri.008G162600.1.p locus=Potri.008G162600 ID=Potri.008G162600.1.v4.1 annot-version=v4.1
ATGGGCGAGCCTTTCTTCGATCTAATGGAGTTTCTAAAGACACCTTCCATAACTGAAACACTCGTCGACATTTTGCTATGTGCAGTACCGATATGGCTAT
CCGTTATGATCGGCCTCGTTATTGGCTGGTCTTGGCGGCCTAGGTGGACTGGCTTGGTCTTTCTTGGCTTGAGGAGCAAGTTTAGGTTCCTTTGGACTGC
GCCTCCTGGATTCGGAGCTCGGCGTCTCTGGCTCGCTTTTACGGCTATCTCGGCCTTTTCTGTTTGCCGCACCATTTGGTCCAATTTCCAGGGTAAAAAT
AGAAAATCAGCACCCGCCGCTGCGGCTTCATCTTCGGCAACCTCACAGAGGAATCCAGGGGGGAGAAGTGGCGGTTCTATTAGCTCCTCTGGTGAGTTAG
AGGACAGGGAGGACATTGTCACTGAGAATGACTTAGAACACCTATTGCATCTGCTGGAGGGGAAGGATAGACAGATGGAATGGCAATGTATGATGGAAAG
GTCAACCTCAAACATGAGATACCAAGCTTGGCGCCATGAGCCTCAGGAAGGTCCCACTGTTTACCGAAGTAGATCTGTCTTTGAGGATGCGACTCCAGAG
TTGGTTAGAGATTTCTTCTGGGATGATGAGTTTCGTCCTAAATGGGATACAATGCTTGCTTACTTCAAAATACTTGAAGAATATCCTCATACAGGAACAA
TGATTGTGCACTGGATAAAAAAGTTCCCATTTTTCTGTAGTGATCGAGAATATATCATTGGTCGAAGAATATGGGATGCTGGGAAGACATATTATTGCGT
GACCAAGGGGGTGCCTTATCCAGGCCTGCACAAGCGTGACAAGTTAAGGCGTGTTGACCTTTATTTCTCAGGTTGGGTTATTAGGGCAGTGGAATCTCGT
AAAGGAGACGGACAGATTTCTGCATGTGAGGTTACCCTTTTACATTACGAGGACATGGGGATACCCAAAGATGTGGCCAAGTTGGGGGTTCGTCATGCGA
TGTGGGGAGCAGTGAAGAAACTGCATTCTGGTATGAGAGCATACCAGAATGCAAGGAAATCAGAAGCTTCGTTGTCCAGATGCGCGCTTATGGCAAGAAT
TACCACAAAAGTGTCTTTTGATGAAGGCATGGATTCTTCAGAAACTGCTAATGAGGAGGAGGATAGAAGTCCAGCTGTAGATATCCAAAGACACAAGGAT
CACGGTATTGATTGGAAATGGATAGCTGTAGGCGGAACAGTAGCACTGGTTTGCGGTCTTCACACTGGTGCGATTGGCAAGGCTTTGTTACTTGGAGCAG
GGCAAAGACTTGCACGGAAGTGA
AA sequence
>Potri.008G162600.1 pacid=42807184 polypeptide=Potri.008G162600.1.p locus=Potri.008G162600 ID=Potri.008G162600.1.v4.1 annot-version=v4.1
MGEPFFDLMEFLKTPSITETLVDILLCAVPIWLSVMIGLVIGWSWRPRWTGLVFLGLRSKFRFLWTAPPGFGARRLWLAFTAISAFSVCRTIWSNFQGKN
RKSAPAAAASSSATSQRNPGGRSGGSISSSGELEDREDIVTENDLEHLLHLLEGKDRQMEWQCMMERSTSNMRYQAWRHEPQEGPTVYRSRSVFEDATPE
LVRDFFWDDEFRPKWDTMLAYFKILEEYPHTGTMIVHWIKKFPFFCSDREYIIGRRIWDAGKTYYCVTKGVPYPGLHKRDKLRRVDLYFSGWVIRAVESR
KGDGQISACEVTLLHYEDMGIPKDVAKLGVRHAMWGAVKKLHSGMRAYQNARKSEASLSRCALMARITTKVSFDEGMDSSETANEEEDRSPAVDIQRHKD
HGIDWKWIAVGGTVALVCGLHTGAIGKALLLGAGQRLARK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14500 Polyketide cyclase/dehydrase a... Potri.008G162600 0 1
AT5G60570 Galactose oxidase/kelch repeat... Potri.013G077800 1.00 0.6985
AT5G66210 CPK28 calcium-dependent protein kina... Potri.007G057600 11.53 0.6048 CPK16,Pt-CPK16.1
AT1G23390 Kelch repeat-containing F-box ... Potri.010G042900 24.97 0.6402
AT3G14620 CYP72A8 "cytochrome P450, family 72, s... Potri.011G117600 28.14 0.5662 CYP72D1
AT4G00660 ATRH8 RNAhelicase-like 8 (.1.2) Potri.002G157500 28.98 0.5847
AT4G24015 RING/U-box superfamily protein... Potri.001G088400 29.98 0.5569
AT1G15240 Phox-associated domain;Phox-li... Potri.001G183100 30.08 0.6303
AT5G04560 DME1, DME DEMETER, HhH-GPD base excision... Potri.008G025900 35.49 0.5920
AT5G50350 unknown protein Potri.012G094200 71.59 0.5669
AT2G35920 RNA helicase family protein (.... Potri.016G068900 81.90 0.5412

Potri.008G162600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.