Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23200 174 / 2e-56 Uncharacterised protein family (UPF0497) (.1) AT3G53850 131 / 7e-40 Uncharacterised protein family (UPF0497) (.1) AT5G02060 123 / 2e-36 Uncharacterised protein family (UPF0497) (.1) AT2G28370 103 / 2e-28 Uncharacterised protein family (UPF0497) (.1) AT2G37200 79 / 5e-19 Uncharacterised protein family (UPF0497) (.1) AT3G50810 52 / 7e-09 Uncharacterised protein family (UPF0497) (.1) AT1G49405 50 / 4e-08 Uncharacterised protein family (UPF0497) (.1) AT4G37235 49 / 7e-08 Uncharacterised protein family (UPF0497) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G073000 [exp] 211 / 3e-71 AT3G23200 182 / 7e-60 Uncharacterised protein family (UPF0497) (.1) Potri.006G090400 [exp] 140 / 3e-43 AT3G53850 193 / 5e-64 Uncharacterised protein family (UPF0497) (.1) Potri.010G198700 [exp] 133 / 1e-40 AT3G53850 206 / 5e-69 Uncharacterised protein family (UPF0497) (.1) Potri.009G014600 [exp] 92 / 4e-24 AT2G28370 256 / 2e-88 Uncharacterised protein family (UPF0497) (.1) Potri.004G211400 [exp] 89 / 8e-23 AT2G28370 221 / 2e-74 Uncharacterised protein family (UPF0497) (.1) Potri.016G090100 [exp] 87 / 6e-22 AT2G28370 216 / 3e-72 Uncharacterised protein family (UPF0497) (.1) Potri.009G110200 [exp] 84 / 4e-21 AT3G50810 165 / 5e-53 Uncharacterised protein family (UPF0497) (.1) Potri.004G149332 [exp] 79 / 2e-19 AT3G50810 145 / 3e-45 Uncharacterised protein family (UPF0497) (.1) Potri.007G033600 [exp] 44 / 4e-06 AT4G37235 133 / 1e-40 Uncharacterised protein family (UPF0497) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022188 [exp] 172 / 4e-56 AT3G23200 206 / 3e-69 Uncharacterised protein family (UPF0497) (.1) Lus10021202 [exp] 154 / 1e-45 AT1G06620 202 / 2e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004698 [exp] 135 / 5e-41 AT3G53850 213 / 6e-72 Uncharacterised protein family (UPF0497) (.1) Lus10040264 [exp] 132 / 8e-37 AT3G55610 486 / 1e-165 delta 1-pyrroline-5-carboxylate synthase 2 (.1.2) Lus10041312 [exp] 100 / 3e-27 AT2G28370 258 / 9e-89 Uncharacterised protein family (UPF0497) (.1) Lus10037399 [exp] 100 / 3e-27 AT2G28370 259 / 4e-89 Uncharacterised protein family (UPF0497) (.1) Lus10000718 [exp] 97 / 8e-26 AT2G28370 254 / 2e-87 Uncharacterised protein family (UPF0497) (.1) Lus10024355 [exp] 94 / 1e-25 AT3G53850 147 / 7e-47 Uncharacterised protein family (UPF0497) (.1) Lus10010881 [exp] 95 / 2e-25 AT3G53850 143 / 2e-44 Uncharacterised protein family (UPF0497) (.1) Lus10021469 [exp] 94 / 9e-25 AT2G28370 258 / 7e-89 Uncharacterised protein family (UPF0497) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0396 [poplar] [flax] Marvel-like PF04535 [poplar] [flax] DUF588 Domain of unknown function (DUF588)
Representative CDS sequence Show only first row Show all	>Potri.008G165500.1 pacid=42808494 polypeptide=Potri.008G165500.1.p locus=Potri.008G165500 ID=Potri.008G165500.1.v4.1 annot-version=v4.1 ATGAGGGATTTTGCTGGGACTCCGGGGACTTTGACTGGGCTTGCTTTGAGGCTTTCGCAGTGTGTTTTTGCAGCTGGCTCCATTACTGCCATGACCACCA CCACTAGCTTCTTCGATTTCACTGCTTTCTGCTACCTCATCGCTTCAATGGGTCTGCAAGTCATCTGGAGCTTTGGACTAGCACTGTTGGATGTATATGC TTTGGTGAAAAAGAAGGCCCTCCACAACACTGTCTTGCTCAGCCTTTTTGTCGTTGGAGACTGGGTGACGGCAATATTGTCTCTTGCGGCCGCTTCAGCT TCGGCAGGCATCACAGTGCTCTACTTCCATGACTTGGGGAATTGTGGTTTTGTGGGGGAGTGCCAAAAATACCAAATGTCAGTTGCATTAGCATTTTTTA GCTGGATAACTATTGCAGTATCATCTCTAATCATGCTTTGGCTATTGGCTGCAGGTTAG
AA sequence Show only first row Show all	>Potri.008G165500.1 pacid=42808494 polypeptide=Potri.008G165500.1.p locus=Potri.008G165500 ID=Potri.008G165500.1.v4.1 annot-version=v4.1 MRDFAGTPGTLTGLALRLSQCVFAAGSITAMTTTTSFFDFTAFCYLIASMGLQVIWSFGLALLDVYALVKKKALHNTVLLSLFVVGDWVTAILSLAAASA SAGITVLYFHDLGNCGFVGECQKYQMSVALAFFSWITIAVSSLIMLWLLAAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23200			Uncharacterised protein family...		Potri.008G165500 [exp]	0	1
AT1G32320		ATMKK10	MAP kinase kinase 10 (.1)		Potri.001G138800 [exp]	2.23	0.8709	Pt-ATMKK10.1
AT3G05990			Leucine-rich repeat (LRR) fami...		Potri.010G090800 [exp]	3.46	0.8871
AT3G01810			unknown protein		Potri.001G333200 [exp]	5.09	0.9042
AT1G30620		MURUS4, HSR8, U...	UDP-D-XYLOSE 4-EPIMERASE 1, MU...		Potri.011G156100 [exp]	8.36	0.8586	MUR4.2
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Potri.016G134500 [exp]	10.48	0.8913
AT2G40540		ATKUP2, ATKT2, ...	potassium transporter 2 (.1.2)		Potri.013G083400 [exp]	12.00	0.8753	Pt-KT2.2
AT4G27430		CIP7	COP1-interacting protein 7 (.1...		Potri.011G122900 [exp]	19.05	0.8578	Pt-CIP7.1
AT1G52760		LysoPL2	lysophospholipase 2 (.1)		Potri.001G175000 [exp]	21.49	0.8671
AT4G28640	AUX_IAA	IAA11	indole-3-acetic acid inducible...		Potri.002G256600 [exp]	21.90	0.8638	Pt-IAA11.1
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Potri.007G107200 [exp]	22.44	0.8664

Compare expression of checked genes

Potri.008G165500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.