Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04400 249 / 9e-80 FHA, AT-PHH1, CRY2, ATCRY2 cryptochrome 2 (.1.2) AT4G08920 209 / 3e-64 OOP2, HY4, BLU1, CRY1, ATCRY1 OUT OF PHASE 2, ELONGATED HYPOCOTYL 4, BLUE LIGHT UNINHIBITED 1, cryptochrome 1 (.1) AT5G24850 68 / 2e-13 CRY3 cryptochrome 3 (.1) AT3G15620 58 / 5e-10 UVR3 UV REPAIR DEFECTIVE 3, DNA photolyase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G071200 [exp] 295 / 2e-97 AT1G04400 799 / 0.0 cryptochrome 2 (.1.2) Potri.002G096900 [exp] 224 / 8e-70 AT4G08920 1017 / 0.0 OUT OF PHASE 2, ELONGATED HYPOCOTYL 4, BLUE LIGHT UNINHIBITED 1, cryptochrome 1 (.1) Potri.005G164700 [exp] 221 / 2e-68 AT4G08920 999 / 0.0 OUT OF PHASE 2, ELONGATED HYPOCOTYL 4, BLUE LIGHT UNINHIBITED 1, cryptochrome 1 (.1) Potri.006G277500 [exp] 67 / 5e-13 AT5G24850 781 / 0.0 cryptochrome 3 (.1) Potri.003G060000 [exp] 57 / 2e-09 AT3G15620 908 / 0.0 UV REPAIR DEFECTIVE 3, DNA photolyase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021188 [exp] 270 / 4e-89 AT1G04400 747 / 0.0 cryptochrome 2 (.1.2) Lus10011822 [exp] 275 / 5e-89 AT1G04400 781 / 0.0 cryptochrome 2 (.1.2) Lus10020930 [exp] 203 / 1e-62 AT4G08920 899 / 0.0 OUT OF PHASE 2, ELONGATED HYPOCOTYL 4, BLUE LIGHT UNINHIBITED 1, cryptochrome 1 (.1) Lus10033446 [exp] 205 / 3e-62 AT4G08920 1009 / 0.0 OUT OF PHASE 2, ELONGATED HYPOCOTYL 4, BLUE LIGHT UNINHIBITED 1, cryptochrome 1 (.1) Lus10033499 [exp] 64 / 3e-12 AT5G24850 440 / 4e-153 cryptochrome 3 (.1) Lus10020878 [exp] 64 / 7e-12 AT5G24850 732 / 0.0 cryptochrome 3 (.1) Lus10000521 [exp] 56 / 2e-09 AT3G15620 295 / 7e-98 UV REPAIR DEFECTIVE 3, DNA photolyase family protein (.1.2) Lus10022095 [exp] 48 / 2e-06 AT3G15620 725 / 0.0 UV REPAIR DEFECTIVE 3, DNA photolyase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03441 [poplar] [flax] FAD_binding_7 FAD binding domain of DNA photolyase
Representative CDS sequence Show only first row Show all	>Potri.008G166632.1 pacid=42807099 polypeptide=Potri.008G166632.1.p locus=Potri.008G166632 ID=Potri.008G166632.1.v4.1 annot-version=v4.1 ATGGTCCCCAGGTTGGGGCAATGCTGTAAGGCTCTAGCTGAATTTGTTGAACAGCATCTAGTTGGCCATGCAAAGAGTAGGCTAAGAGTTGGGTCCTTCT CCTCACTTTTGTCCCCGTATCTTCATTTTGGAGAGCTGAGTGTGAGGAAAGTTTTCTGGTGTGTGCAAATGAAGCAGTTATTGTGGTCAAAAGAAGAGAA CTCGGTGGGGAAAGAAAGCGTGACTCAGTTTCTTAGATCCATCGGGCTTAGGGAATGCTCCCGTTATCTTTGTTTTAATTTTCCATTCACTCATGAGAGA TTATTGTTGAGCAACTTAAAGTATTTTCCATGGAATGCCAATCAGGTCCATTTTAAGGCTTGGAGACAGGGACGGACTGGTTACCCGTTAGTTGACGATG GAATGCGTGAGCTTTGGGCAATTGGTTGGATACACAACAGAATAAGAGCAATTGTTTCCAGCTTTGCTGTAAAAGTTCTTCTTCTTCCATGGAGATGGGG GTTGAAGTATTTCTGGGACACTTTTGGATGCAGATTTGGAAAGCGATATCCTTGGTTGGCAGTATATTTCGGGCAGCTTACCAGATGCTCATGA
AA sequence Show only first row Show all	>Potri.008G166632.1 pacid=42807099 polypeptide=Potri.008G166632.1.p locus=Potri.008G166632 ID=Potri.008G166632.1.v4.1 annot-version=v4.1 MVPRLGQCCKALAEFVEQHLVGHAKSRLRVGSFSSLLSPYLHFGELSVRKVFWCVQMKQLLWSKEENSVGKESVTQFLRSIGLRECSRYLCFNFPFTHER LLLSNLKYFPWNANQVHFKAWRQGRTGYPLVDDGMRELWAIGWIHNRIRAIVSSFAVKVLLLPWRWGLKYFWDTFGCRFGKRYPWLAVYFGQLTRCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04400		FHA, AT-PHH1, C...	cryptochrome 2 (.1.2)		Potri.008G166632 [exp]	0	1
					Potri.008G166566 [exp]	1.00	0.8550
AT3G15351			unknown protein		Potri.014G057550 [exp]	2.00	0.8081
AT4G27190			NB-ARC domain-containing disea...		Potri.013G015700 [exp]	4.00	0.8187
AT2G40270			Protein kinase family protein ...		Potri.010G185300 [exp]	8.83	0.7313
AT3G14470			NB-ARC domain-containing disea...		Potri.004G170700 [exp]	11.83	0.8076
AT2G39490			F-box family protein (.1)		Potri.008G050800 [exp]	15.19	0.7914
AT5G41620			unknown protein		Potri.014G093400 [exp]	19.44	0.7509
AT3G14470			NB-ARC domain-containing disea...		Potri.004G170232 [exp]	21.21	0.7879
AT5G41070		DRB5	dsRNA-binding protein 5 (.1)		Potri.017G063700 [exp]	23.97	0.7486
AT3G20480		AtLpxK	lipid X K, tetraacyldisacchari...		Potri.001G418800 [exp]	26.22	0.7657

Compare expression of checked genes

Potri.008G166632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.