Potri.008G169800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G33450 194 / 1e-64 Ribosomal L28 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G068500 224 / 3e-76 AT2G33450 202 / 8e-68 Ribosomal L28 family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023747 184 / 2e-60 AT2G33450 180 / 3e-59 Ribosomal L28 family (.1)
Lus10011792 180 / 2e-57 AT2G33450 178 / 1e-56 Ribosomal L28 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00830 Ribosomal_L28 Ribosomal L28 family
Representative CDS sequence
>Potri.008G169800.2 pacid=42806590 polypeptide=Potri.008G169800.2.p locus=Potri.008G169800 ID=Potri.008G169800.2.v4.1 annot-version=v4.1
ATGATCTCTAACCCAACCCAAGTCAATACACACACCCCCATCAAAATAAGGGGCCGCAAATACAATAGCAGCTCCTGCTTCACATGTTATCCGTTTCTGC
CAATTCGAGAGGCAAAAGCACATAACAATCCGGTTTCGGTTTCAGAGATAGGATTTCTTACTTCCCAATTGGGTGGCATCAGGATTTCCTACAACCCACC
AAAACCACTCACTGCTCCTTTCACTCCCGCTATCCAACCTCTCGTCGCACGTAGAATTTGCCCCTTTACCGGGAAGAAAGCCAACAGGGCCAACAAAGTT
TCCTTTTCAAACCACAAGACCAAGAAGTTGCAGTTTGTCAACTTGCAGTACAAGAGGGTGTGGTGGGAAGCTGGCAAGCGCTATGTCAAGCTGCGATTGT
CAACCAAAGCGTTAAAGACTAAACAGAAGAACGGACTGGATGCTGTTGCTAAGAAGGCTGGCATAGATCTTCGCAAAGAGTGA
AA sequence
>Potri.008G169800.2 pacid=42806590 polypeptide=Potri.008G169800.2.p locus=Potri.008G169800 ID=Potri.008G169800.2.v4.1 annot-version=v4.1
MISNPTQVNTHTPIKIRGRKYNSSSCFTCYPFLPIREAKAHNNPVSVSEIGFLTSQLGGIRISYNPPKPLTAPFTPAIQPLVARRICPFTGKKANRANKV
SFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTKQKNGLDAVAKKAGIDLRKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G33450 Ribosomal L28 family (.1) Potri.008G169800 0 1
AT3G27160 GHS1 GLUCOSE HYPERSENSITIVE 1, Ribo... Potri.001G331600 1.41 0.9802 GHS1.1
AT1G49975 unknown protein Potri.001G292000 5.09 0.9771
AT5G36160 Tyrosine transaminase family p... Potri.017G013800 6.24 0.9415
AT1G67700 unknown protein Potri.010G053600 6.70 0.9690
AT3G53470 unknown protein Potri.016G084000 8.06 0.9674
AT3G55800 SBPASE sedoheptulose-bisphosphatase (... Potri.008G063800 8.71 0.9688
AT3G03620 MATE efflux family protein (.1... Potri.013G069600 9.79 0.9379
AT3G21750 UGT71B1 UDP-glucosyl transferase 71B1 ... Potri.016G016000 10.95 0.9669
AT3G50560 NAD(P)-binding Rossmann-fold s... Potri.005G136200 12.16 0.9104
AT5G66530 Galactose mutarotase-like supe... Potri.007G023200 12.40 0.9516

Potri.008G169800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.